DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GLRA2 and HisCl1

Sequence 1:NP_001112357.1 Gene:GLRA2 HGNCID:4327 Length:452 Species:Homo sapiens
Sequence 2:NP_731632.1 Gene:HisCl1 FlyBaseID:FBgn0037950 Length:426 Species:Drosophila melanogaster

Alignment Length:448 Identity:160/449 (36%)
Similarity:231/449 (51%) Gaps:51/449 (11%)


Human     8 ILTALFAFFLETNHFRTAFCKDHDSRSGKQPSQ-------TLSPSDFLDKLMGRTSGYDARIRPN 65
            |..|::...||.: .:...|. |..|:..:.::       :||..|.| .:..:|  ||....|.
  Fly    15 IALAIYLHALEQS-IQHCHCV-HGYRNNTESAELVSHYESSLSLPDIL-PIPSKT--YDKNRAPK 74

Human    66 FKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYPDDS---LDLDPSMLDSI 127
            ..|.|..|..::.:.|..|:.|.:|.|..:|||.|.|.|.||...|...:.   ||:|  .|.||
  Fly    75 LLGQPTVVYFHVTVLSLDSINEESMTYVTDIFLAQSWRDPRLRLPENMSEQYRILDVD--WLHSI 137

Human   128 WKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLES 192
            |:||.||.|.|...||:::..|..|.:..:..:||..:|||.|||.|..:::|.|.|.|:|.:||
  Fly   138 WRPDCFFKNAKKVTFHEMSIPNHYLWLYHDKTLLYMSKLTLVLSCAMKFESYPHDTQICSMMIES 202

Human   193 FGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKHYNTGKFTCIEVKFHLERQMGYY 257
            ..:|:.||:|.|....|:.|...:.|||..:....... ||..|:||.|||:.:.|:|.|::||:
  Fly   203 LSHTVEDLVFIWNMTDPLVVNTEIELPQLDISNNYTTD-CTIEYSTGNFTCLAIVFNLRRRLGYH 266

Human   258 LIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMA 322
            |...||||.|||::||:||||..:|.||||.||:|::||:.||::.|:.|||.||||||||:||:
  Fly   267 LFHTYIPSALIVVMSWISFWIKPEAIPARVTLGVTSLLTLATQNTQSQQSLPPVSYVKAIDVWMS 331

Human   323 VCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQNKEEDVTRESRFNFSGYGMGHCLQVKDGT 387
            .|.:|||.:|:|:|.||                   |....|..::   ..||...:...:.|..
  Fly   332 SCSVFVFLSLMEFAVVN-------------------NFMGPVATKA---MKGYSDENISDLDDLK 374

Human   388 AVKATPANPLPQPPKD----GDAIKKKFVDRAKRIDTISRAAFPLAFLIFNIFYWITY 441
            :........:.:|..|    |.|       .|..||..||..||.:|.|.||.||.|:
  Fly   375 SALQHHRESIIEPQYDTFCHGHA-------TAIYIDKFSRFFFPFSFFILNIVYWTTF 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GLRA2NP_001112357.1 LIC 46..441 CDD:273305 151/402 (38%)
Strychnine-binding. {ECO:0000250|UniProtKB:O93430} 236..241 3/5 (60%)
HisCl1NP_731632.1 Neur_chan_LBD 67..262 CDD:280998 74/198 (37%)
Neur_chan_memb 270..>350 CDD:280999 49/99 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D276914at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.778 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.