DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GLRA2 and Grd

Sequence 1:NP_001112357.1 Gene:GLRA2 HGNCID:4327 Length:452 Species:Homo sapiens
Sequence 2:NP_524131.1 Gene:Grd FlyBaseID:FBgn0001134 Length:686 Species:Drosophila melanogaster

Alignment Length:596 Identity:180/597 (30%)
Similarity:254/597 (43%) Gaps:201/597 (34%)


Human    32 SRSGKQPSQTLSP-------SDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSVTETT 89
            |.|...||..|:.       |:.||.|:   .|||..|||:|.|||..:..:|.:.|.|.::|..
  Fly    90 SLSSSLPSSWLTQSNNHANISELLDNLL---RGYDNSIRPDFGGPPATIEVDIMVRSMGPISEVD 151

Human    90 MDYRVNIFLRQQWNDSRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRI 154
            |.|.::.:.||.|.|.|||: |...|:|.|..|||..|||||.:|.|.|.:..|.:||.||.:||
  Fly   152 MTYSMDCYFRQSWVDKRLAF-EGAQDTLALSVSMLARIWKPDTYFYNGKQSYLHTITTPNKFVRI 215

Human   155 SKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSD-GPVQVAEGLTL 218
            .:||:||||.|||:...|||:|.:||||:|.|.::..|||||.:|:|:.|..: .||.:||.:.|
  Fly   216 YQNGRVLYSSRLTIKAGCPMNLADFPMDIQKCPLKFGSFGYTTSDVIYRWNKERPPVAIAEDMKL 280

Human   219 PQFILKE------------------------EKE------------LGYCTKH------------ 235
            .||.|.:                        .|:            .|...|:            
  Fly   281 SQFDLVDCPAGNLTDIVYKAAAPRPQRRPFNNKDPPRPTSKVMTTFAGPAAKNQHVRGTGLKLDK 345

Human   236 --YNTGK-------------------------FTCIEVKFHLERQMGYYLIQMYIPSLLIVILSW 273
              :.||:                         ::.:.|.|||:|.||.:|||:|.|..|:|:|||
  Fly   346 GAFGTGRDATGGSGSTTGLSGTITLETNHPSEYSMLMVNFHLQRHMGNFLIQVYGPCCLLVVLSW 410

Human   274 VSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAV 338
            ||||:|.:|...||:||||||||||.....:|..||||||..|:|.::.:...|:||.:|::|.|
  Fly   411 VSFWLNREATADRVSLGITTVLTMTFLGLEARTDLPKVSYPTALDFFVFLSFGFIFATILQFAVV 475

Human   339 NFV-------------------------------------------------------------- 341
            ::.                                                              
  Fly   476 HYYTKYGSGECYFIIEELDSESGESETEPLTSDFRGSTESKIYEVIPLSMCAISMPPPPTRLGML 540

Human   342 --------SRQH----KEFLRL---RRRQK--RQNKEEDVTRES---RFNFSGYGMGHCLQVKDG 386
                    :|:|    .:.|.|   |||:|  |.:.:||...|.   |.|.:           ..
  Fly   541 TSRNRRPRNRRHGLWSMKLLGLFDWRRRRKPPRADSDEDEDDEQTQLRANEA-----------PT 594

Human   387 TAVKATPANPLPQ-----PPKDG------------DAIKK----KFVDRAKRIDTISRAAFPLAF 430
            |:..|..|....|     ||..|            :|.:|    ...:...:||..||..|||.|
  Fly   595 TSAAAAAAQAAAQAARISPPTGGRRRMSYYRREEMEARRKGKRTPQYNSVSKIDRASRIVFPLLF 659

Human   431 LIFNIFYWITY 441
            ::.|:|||..|
  Fly   660 ILINVFYWYGY 670

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GLRA2NP_001112357.1 LIC 46..441 CDD:273305 173/574 (30%)
Strychnine-binding. {ECO:0000250|UniProtKB:O93430} 236..241 2/30 (7%)
GrdNP_524131.1 Neur_chan_LBD 110..326 CDD:280998 85/220 (39%)
LIC 111..670 CDD:273305 173/574 (30%)
Neur_chan_memb 398..667 CDD:280999 74/280 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.