DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GLRA2 and CG7589

Sequence 1:NP_001112357.1 Gene:GLRA2 HGNCID:4327 Length:452 Species:Homo sapiens
Sequence 2:NP_001261986.1 Gene:CG7589 FlyBaseID:FBgn0036727 Length:509 Species:Drosophila melanogaster

Alignment Length:458 Identity:127/459 (28%)
Similarity:208/459 (45%) Gaps:88/459 (19%)


Human    58 YDARIRP-----NFKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEY-PDDS 116
            ||...||     :.|..|:.|...|::....::....:.::::..|:.::.|.||||..: ..|:
  Fly    57 YDRLERPFEYDSDGKRLPIVVKTRIYVYFLQNLNSDLLQFKMHALLQLRFQDKRLAYKAFNRSDN 121

Human   117 LDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNK--LLRISKNGKVLYSIRLTLTLSCPMDLKNF 179
            :.....:.:.:|.|.:|||||:.::.  :.||.|  |..:|..|.|:.|.|:..:|.|.|:.:.|
  Fly   122 ILGQKHLSERLWLPHIFFANERESSI--LGTDEKDVLTSLSPEGNVIISTRMQASLYCWMNFQKF 184

Human   180 PMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKHYNT------ 238
            |.|.|.|:..|||:.|..:|||.||....|:.....:.|.::.:.:        ..:||      
  Fly   185 PFDQQFCSTVLESWMYNTSDLILEWEPHTPISFDPEMRLTEYNMAQ--------FWHNTTIVQSD 241

Human   239 ----------GKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITT 293
                      |.::.:....:|:|::|:||:..|:||::||.:||||||:..||:|.|:.||.:|
  Fly   242 GDNLRHGAFAGNYSSLSFTVNLKREIGFYLLDYYLPSMMIVAISWVSFWLQADASPPRIMLGTST 306

Human   294 VLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRR----- 353
            :|:..|.||....:||||||:|..::|...|..|:|.:|:|:|.||.:.|: ||.:.|::     
  Fly   307 MLSFITLSSSQSKNLPKVSYIKVSEVWFLGCTFFIFGSLVEFAFVNTIWRR-KENIELKKVNSKY 370

Human   354 --------RQKRQNKEEDVTRESRF-------------------------NFSGYGMGH------ 379
                    |..|:.....::.|||.                         .|:.|...|      
  Fly   371 IIKSTLTPRPARRQIGGSLSNESRARSCSSLDNIVSSTESVRNGNGTVNQGFNNYLTVHPNLPII 435

Human   380 ---CLQVKDGTAVKATPANP-LPQPPKDGDAIKKKFV-----DRAKRIDTISRAAFPLAFLIFNI 435
               |.:....:...|...|. :....||.......|.     :.|..||..||..||..||.||.
  Fly   436 RTECAEADTVSICSARTNNDHIVDVDKDKKDTPPTFTTMTPQEIAMWIDRRSRFLFPAMFLAFNA 500

Human   436 FYW 438
            .||
  Fly   501 LYW 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GLRA2NP_001112357.1 LIC 46..441 CDD:273305 127/459 (28%)
Strychnine-binding. {ECO:0000250|UniProtKB:O93430} 236..241 3/21 (14%)
CG7589NP_001261986.1 LIC 43..505 CDD:273305 127/459 (28%)
Neur_chan_LBD 44..267 CDD:280998 55/220 (25%)
Neur_chan_memb 275..503 CDD:280999 68/229 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.610 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.