DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GLRA2 and Rdl

Sequence 1:NP_001112357.1 Gene:GLRA2 HGNCID:4327 Length:452 Species:Homo sapiens
Sequence 2:NP_001261617.1 Gene:Rdl FlyBaseID:FBgn0004244 Length:608 Species:Drosophila melanogaster

Alignment Length:528 Identity:174/529 (33%)
Similarity:257/529 (49%) Gaps:150/529 (28%)


Human    58 YDARIRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYPD-DSLDLDP 121
            ||.|:|||:.||||.|...:::.|..|::|..||:.::.:.||.|.|.||||.:.|. ::|.:..
  Fly    70 YDKRVRPNYGGPPVEVGVTMYVLSISSLSEVKMDFTLDFYFRQFWTDPRLAYRKRPGVETLSVGS 134

Human   122 SMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTC 186
            ..:.:||.||.||.|||.:.||..||.|:.:|:..:|.:..|||||:|.||||:|:.||||.|.|
  Fly   135 EFIKNIWVPDTFFVNEKQSYFHIATTSNEFIRVHHSGSITRSIRLTITASCPMNLQYFPMDRQLC 199

Human   187 TMQLESFGYTMNDLIFEWLSDG--PVQVAEGLTLPQFILKEEKELGYCTK----HYNTGKFTCIE 245
            .:::|||||||.|:.:.| .||  .|.::..:.||||     :.||:..:    :..||.::.:.
  Fly   200 HIEIESFGYTMRDIRYFW-RDGLSSVGMSSEVELPQF-----RVLGHRQRATEINLTTGNYSRLA 258

Human   246 VKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPK 310
            .:....|.|||||||:||||.||||:||||||:|.:|.|||||||:||||||||..|.:.|:|||
  Fly   259 CEIQFVRSMGYYLIQIYIPSGLIVIISWVSFWLNRNATPARVALGVTTVLTMTTLMSSTNAALPK 323

Human   311 VSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSR----QHKEFLRLRRRQKRQNKEEDVTRESRFN 371
            :||||:||:::..|.:.|||:|||||.|.::::    :.:.|:.:::..:::.::.|...:.:.|
  Fly   324 ISYVKSIDVYLGTCFVMVFASLLEYATVGYMAKRIQMRKQRFMAIQKIAEQKKQQLDGANQQQAN 388

Human   372 FS-----------------------------GYGMG---------HCLQVKDGTAVKATPAN--- 395
            .:                             |.|||         |........|.|.|.:|   
  Fly   389 PNPNANVGGPGGVGVGPGGPGGPGGGVNVGVGMGMGPEHGHGHGHHAHSHGHPHAPKQTVSNRPI 453

Human   396 ------------------PL------------------------------PQ------------- 399
                              ||                              ||             
  Fly   454 GFSNIQQNVGTRGCSIVGPLFQEVRFKVHDPKAHSKGGTLENTVNGGRGGPQSHGPGPGQGGGPP 518

Human   400 -----------PPKDG--------------DAIKK-KFVDR-----AKRIDTISRAAFPLAFLIF 433
                       ||:.|              ..:|| |.:::     ...||..||..||:.|:.|
  Fly   519 GGGGGGGGGGGPPEGGGDPEAAVPAHLLHPGKVKKVKDINKLLGITPSDIDKYSRIVFPVCFVCF 583

Human   434 NIFYWITY 441
            |:.|||.|
  Fly   584 NLMYWIIY 591

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GLRA2NP_001112357.1 LIC 46..441 CDD:273305 173/527 (33%)
Strychnine-binding. {ECO:0000250|UniProtKB:O93430} 236..241 2/5 (40%)
RdlNP_001261617.1 Neur_chan_LBD 61..>381 CDD:332142 141/317 (44%)
Neur_chan_memb 274..588 CDD:308533 84/314 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128286
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.