DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GLRA2 and CG12344

Sequence 1:NP_001112357.1 Gene:GLRA2 HGNCID:4327 Length:452 Species:Homo sapiens
Sequence 2:NP_001286298.1 Gene:CG12344 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster

Alignment Length:441 Identity:148/442 (33%)
Similarity:219/442 (50%) Gaps:73/442 (17%)


Human    37 QPSQTLSPSDFLDKLMGRTSGYDARIR-PNFKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQ 100
            :|...|.|:            |...|| |:.||.||.|..:||:....|:....||:||::|:.|
  Fly    35 KPRVVLPPN------------YVKEIRPPSKKGSPVIVDFSIFVVDINSINVEDMDFRVDMFIHQ 87

Human   101 QWNDSRLAYSEYPDDSLD-------LDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNG 158
            :|.:|||   |.|||..:       |.|.:.::.|:||.:|.|.|.|....:|.....:.:.||.
  Fly    88 RWLESRL---EIPDDIFEEGDDYVTLLPEVFENFWQPDPYFLNSKIAEIATLTHKFTSVTLYKNK 149

Human   159 KVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFIL 223
            .|.|:.|:...::|.|:.:.:|||:|.|.:.:|||......:...| ||..|.:...|.|.|:.|
  Fly   150 TVRYAARMHAIIACQMEFQLYPMDIQVCPIYIESFSSNNQKVKLRW-SDSGVTLNPELKLLQYNL 213

Human   224 KEEKEL----GYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAP 284
            .:..||    ||..:  ..|.|:.:.|.|..|||:|::|||.:.||.|:|:|||.|||:.:||.|
  Fly   214 GQPLELEESDGYMPE--KVGNFSRLTVYFRFERQIGHHLIQTFAPSSLVVMLSWFSFWLGLDAIP 276

Human   285 ARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFL 349
            .||.|.:|.:||:.|..:|  |.:|.|:||||:|:|||.|:|.|||||.|:..|..:..|:    
  Fly   277 GRVTLLVTCMLTLVTMFTG--ADIPPVAYVKALDLWMAGCMLSVFAALAEFVVVKVLDVQY---- 335

Human   350 RLRRRQKRQNKEEDVTRESRFNFSGYGMGHCLQVK--DGTAVKATPANPLPQ------------P 400
                 |.:.|:   :.:......|....|.|..|.  :|.||::..|...|.            |
  Fly   336 -----QYQVNR---IPKVLPMRISNMEKGQCATVASWEGGAVRSRKATQTPTTPGQTSLQGNGGP 392

Human   401 PK-------------DGDAIKKKFVDRAKRIDTISRAAFPLAFLIFNIFYW 438
            ||             |.|...:|.:.|  .||.:|||.||:.|.:|.:.||
  Fly   393 PKPARRQSLLSVAWTDTDTGVEKIMWR--EIDKVSRAVFPILFFVFVLLYW 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GLRA2NP_001112357.1 LIC 46..441 CDD:273305 145/433 (33%)
Strychnine-binding. {ECO:0000250|UniProtKB:O93430} 236..241 1/5 (20%)
CG12344NP_001286298.1 Neur_chan_LBD 8..441 CDD:332142 147/440 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3841
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.875 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.