DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GLRA2 and Lcch3

Sequence 1:NP_001112357.1 Gene:GLRA2 HGNCID:4327 Length:452 Species:Homo sapiens
Sequence 2:NP_996469.1 Gene:Lcch3 FlyBaseID:FBgn0010240 Length:496 Species:Drosophila melanogaster

Alignment Length:505 Identity:189/506 (37%)
Similarity:273/506 (54%) Gaps:87/506 (17%)


Human     6 VNILTALFAFFLETNHFRTAFCKDHDSRSGKQPSQTLSPSDFLDKLMGRTSGYDARIRPNFKGPP 70
            |.:...|| |||.....:...|...|..:|:..:.|.:.|:.|       .|||.|:||||.|.|
  Fly     7 VGVSCGLF-FFLLGAQLQLIRCIRKDVLAGRLENVTQTISNIL-------QGYDIRLRPNFGGEP 63

Human    71 VNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYS---EYPDDS--------LDLDPSML 124
            ::|..::.|.||.:::|..|||.:.::|.|.|.|.|||::   :|.||.        |.|.....
  Fly    64 LHVGMDLTIASFDAISEVNMDYTITMYLNQYWRDERLAFNIFGQYFDDENDDGISDVLTLSGDFA 128

Human   125 DSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQ 189
            :.||.||.||||:|.:..||||..|||:|:..:|.|.|.:|.|.||:|.|||..:|:|.|.||::
  Fly   129 EKIWVPDTFFANDKNSFLHDVTERNKLVRLGGDGAVTYGMRFTTTLACMMDLHYYPLDSQNCTVE 193

Human   190 LESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCT----KHYNTGKFTCIEVKFHL 250
            :||:|||::|::..| ...||:..|...||||.:     :||.|    :...||.:..:.:.|.|
  Fly   194 IESYGYTVSDVVMYW-KPTPVRGVEDAELPQFTI-----IGYETNDRKERLATGVYQRLSLSFKL 252

Human   251 ERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVK 315
            :|.:||::.|.|:||:|||:|||||||||.:|..|||||||||||||||.|:|.|:|||::||||
  Fly   253 QRNIGYFVFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPRISYVK 317

Human   316 AIDIWMAVCLLFVFAALLEYAAVNFV---SRQHKEFLRLR----------RRQKRQNKEEDV--- 364
            ||||::.:|.:|||||||||||||:.   .|..|:..:::          .|.:..:..||:   
  Fly   318 AIDIYLVMCFVFVFAALLEYAAVNYTYWGKRAKKKIKKVKECCPGKIGKSERSETCSTTEDIIEL 382

Human   365 ----------TRESRFNFS----------------------GYGMGHC---LQVKDGTAVKATPA 394
                      .|...:|.:                      .||.||.   .:.:.|.:.:....
  Fly   383 QDVRMSPIPSLRRGTYNATLDSIGTETMNLGKFPPSFRITRNYGTGHSQLRRRAQRGISTRPRML 447

Human   395 NPLPQPPKDGDAIKKKFVDRAKR---IDTISRAAFPLAFLIFNIFYWITY 441
            :.|    |.|.:..|..:.:.|.   ||..||..||::||.||:.||:.|
  Fly   448 HAL----KRGASAIKATIPKIKDVNIIDKYSRMIFPISFLAFNLGYWLFY 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GLRA2NP_001112357.1 LIC 46..441 CDD:273305 177/464 (38%)
Strychnine-binding. {ECO:0000250|UniProtKB:O93430} 236..241 2/5 (40%)
Lcch3NP_996469.1 LIC 15..493 CDD:273305 185/495 (37%)
Neur_chan_LBD 47..256 CDD:280998 86/222 (39%)
Neur_chan_memb 263..490 CDD:280999 87/231 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.