DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GLRA2 and CG6927

Sequence 1:NP_001112357.1 Gene:GLRA2 HGNCID:4327 Length:452 Species:Homo sapiens
Sequence 2:NP_572194.1 Gene:CG6927 FlyBaseID:FBgn0029733 Length:524 Species:Drosophila melanogaster

Alignment Length:531 Identity:142/532 (27%)
Similarity:232/532 (44%) Gaps:122/532 (23%)


Human     8 ILTALFAFFLETNHFRTAFCKDHDSRSGKQPSQTLSPSDFLDKLMGRTSG--YDARIRP-----N 65
            :|..|:|         :|...|.|..: .....:||.:..||:|   |.|  ||...||     .
  Fly    10 LLNCLYA---------SASALDEDCPT-LDDGDSLSQTQLLDRL---THGCRYDRLERPITYSET 61

Human    66 FKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYPDDSLDLDPS-------- 122
            .:..||:|....:|....::....:.:::...|:.::.|.||.:.       ::.|.        
  Fly    62 GQRLPVDVYMRAYIYFMQNLEAHDLQFKIYALLQMRYLDPRLNFR-------NVSPKRRQPILGE 119

Human   123 --MLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQT 185
              :.:|:|.|.:|.|||:.::...:|..:.|..||.:|.|:.|.|:..||.|.::||.||.|.|.
  Fly   120 EHLRNSLWMPHIFLANERDSSILGLTEKDILTSISPDGTVIVSNRIKATLYCWLNLKKFPFDEQH 184

Human   186 CTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKE--------EKELGYCTKHYNTGKFT 242
            |:..|||:.|..::|:..|....|:.....|.|.:|:|:.        ..:|.........|.::
  Fly   185 CSTVLESWMYNTSELVLHWEQKRPITYDGALHLTEFVLQRSWSNETVINADLSDLRHGAFAGNYS 249

Human   243 CIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRAS 307
            .:....||.|.:|:||:..::||:|||.:||||||:..|.||.|:.||.:|:||..|.:|....:
  Fly   250 SLSFTVHLTRVVGFYLMDYFLPSMLIVAISWVSFWLQADQAPPRITLGTSTLLTFITLASAQGKT 314

Human   308 LPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQ----------HKEFLR-------LRRRQ 355
            ||||||:|..::|...|.:|:|.:::|:|.||.:.|:          .|..|:       ||||.
  Fly   315 LPKVSYIKVSEVWFLGCTIFIFGSMVEFAFVNTIWRRKKSVPVKKLNSKHILKSTLSPNLLRRRS 379

Human   356 KRQN-----------------------------------KEEDVTRESR---------FNF--SG 374
            ..::                                   ||..|..:.|         .||  |.
  Fly   380 HARSRSFSGTALHKTADTGSLGGAGFNNYLTVNLPITTIKEGQVLDQQRTSRVVQKMDVNFVESA 444

Human   375 YG-MGHCLQVKDGTAVKATPANPLPQPPKDGDAIKKKFVDR-----------AKRIDTISRAAFP 427
            :| ||.....  |....|:.:..|....:...|..::.:|.           |..||:.:|..||
  Fly   445 FGSMGSAQST--GAISAASSSQTLTNNNRTESAGHQEEIDLSGWTTLTPQEIAMWIDSRARFVFP 507

Human   428 LAFLIFNIFYW 438
            |:||:||:|:|
  Fly   508 LSFLVFNLFFW 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GLRA2NP_001112357.1 LIC 46..441 CDD:273305 134/494 (27%)
Strychnine-binding. {ECO:0000250|UniProtKB:O93430} 236..241 1/5 (20%)
CG6927NP_572194.1 LIC 3..520 CDD:273305 142/532 (27%)
Neur_chan_LBD 36..259 CDD:280998 58/233 (25%)
Neur_chan_memb 270..518 CDD:280999 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.