DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mmel1 and Nepl11

Sequence 1:NP_038811.2 Gene:Mmel1 MGIID:1351603 Length:766 Species:Mus musculus
Sequence 2:NP_649449.1 Gene:Nepl11 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster

Alignment Length:786 Identity:156/787 (20%)
Similarity:260/787 (33%) Gaps:253/787 (32%)


Mouse    29 LGAIVTLGVFYSIGKQLPLLTSLLHFSWDERTVVKRALRDSSLKSDICTTPSCVIAAARILE-NM 92
            |..:...|:.|.....|.:.|.||.||.:                               || .:
  Fly     6 LAVLWIAGIAYGQDDLLRVETELLSFSHN-------------------------------LEPYL 39

Mouse    93 DQSRNPCENFYQYACGGWLRHHV-IPETNSRYSVFDILRDELEVILKGVLEDSTSQHRPAVEKAK 156
            |.|:.||::||.|.|.    |.. :.||.         |...:.:||   |...:|......:..
  Fly    40 DTSKQPCQDFYGYVCS----HSANLSETG---------RQRFQSLLK---ETDVAQLMDMELQLI 88

Mouse   157 TLYRSCMNQSVIEKRDSEPLLSVLKMVGGWPV-------AMDKWNETMGLKWELERQLAVLNSQF 214
            ..::||.:...:|......|   .:..||||.       |..:.|:|       :|.|.:|.   
  Fly    89 NFFKSCESGRGVEALKGSQL---YRQSGGWPSLEPNKVNASQRTNQT-------QRWLGLLG--- 140

Mouse   215 NRRVLIDLFIWNDDQNSSRHVIYIDQPTLGMPSREYYFQ-----EDNNHKV--------RKAYLE 266
                                  |..:  :|.|   |:|:     :.|...|        |....:
  Fly   141 ----------------------YFHE--VGAP---YFFETSVTMQSNKRLVVLQPDGTRRNTLRK 178

Mouse   267 FMTSVATMLRKDQNLSKESAMVREEMAEVLELETHLANATVPQEKRHDVTALYHRMDLMELQERF 331
            |...|..:|   |:...|.:.......|||.||          ..|.|:.    :.|.:|.|.:|
  Fly   179 FEQRVGEVL---QSFGIEQSRAHVTALEVLSLE----------RSRRDIV----KADHVEDQVQF 226

Mouse   332 GLKGF-------------NWTLFIQNVLSSVEVELFPDEEVVVYGIPYLENLEDIIDSYSARTMQ 383
            ....|             :|..:.:.:|.....:  ..:.:||..:|.|.....::.:.|...:.
  Fly   227 SYGNFKRIVFGNASLIRLDWDGYFRKLLGGKTPQ--ASDTIVVKQLPRLVEYFALLQNTSMVRLL 289

Mouse   384 NYLVWRLVLDRIGSLSQRFKEARVDYRKALYGTTVEEVRWRECVSYVNSNMESAVGSLYIKRAFS 448
            |::....::|.:.:...:..|.   |...||...|:.|        ..:.:|.|           
  Fly   290 NWIWTDYLMDIVDADCHQLSET---YAGDLYAHVVQRV--------TANRVELA----------- 332

Mouse   449 KDSKSTVRELIEKIRSVFVDNLDELNWMDEESKKKAQEKAMNIREQIGYPDYILEDNNKHLDEEY 513
                    ::..::...:.|.|....|:||.|::.:::...||.       :...:.::.||..|
  Fly   333 --------QMYSELGKAYTDQLGGSVWIDEISRQSSRQFLGNIM-------HTTLNGDERLDAAY 382

Mouse   514 SSL-----TFYEDLYFENGLQNLKNNAQRSLKKLREKVDQNLWIIGAAVVNAFYSPNRNQIVFPA 573
            .|:     :.|.:|......|..:..|..|.:::|.....      .|.||||...:.       
  Fly   383 HSILLGRRSLYRNLEKLRKFQRTRRLASHSAQQVRRYAQM------FAPVNAFLGQHN------- 434

Mouse   574 GILQPPFFSKDQPQSLNFGGIGMVIGHEITHGFDDNGRNFDKNGNMLDWWSNFSARHFQQQSQCM 638
              |..|         ||:    :::|...:......|.:....|   .|.|:.|.|.|....||:
  Fly   435 --LSTP---------LNY----LLLGEFFSRSLVAAGSSSRTQG---AWRSSDSERRFAIFQQCV 481

Mouse   639 IYQYGNFSWELADNQNVNGFSTLGENIADNGGVRQAYKAYLRWLA-DGGKDQRLPGL------NL 696
                         .:..|....|...:|.    |||..||.:||| ..|..:|:..:      .:
  Fly   482 -------------GKQTNAIDLLLSLLAQ----RQALSAYGQWLATQAGLVERVDAVLAAGSSKM 529

Mouse   697 TYAQLFFINYAQVWCGSYRPEFAV--QSIKTDV-HSPLKYRVLGSLQNLPGFSEAFHCPRGSPMH 758
            :..:|||:....|.|   |.|...  |..|..| |:        :|:|.|.|.|||.|..|..::
  Fly   530 SLQRLFFVTSLLVDC---RSELGALQQDRKRQVTHA--------TLRNSPEFLEAFRCRPGDVLY 583

Mouse   759 PM-KRC 763
            |. :||
  Fly   584 PQDQRC 589

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mmel1NP_038811.2 PepO 89..766 CDD:226118 147/727 (20%)
M13 97..764 CDD:189000 143/718 (20%)
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 142/715 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.