DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Akr1c13 and CG2767

Sequence 1:XP_006516545.1 Gene:Akr1c13 MGIID:1351662 Length:324 Species:Mus musculus
Sequence 2:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster

Alignment Length:319 Identity:115/320 (36%)
Similarity:190/320 (59%) Gaps:15/320 (5%)


Mouse    19 DGEKEDLVKINV--PKSKSLEAAC-LALDVGYRHVDTAYAYQVEEEIGQAIQSKIKAGVVKREDL 80
            :|||..::.|..  ...:.:|.|. .||:.||||:|||..|..|:.||:.::..:.||.||||:|
  Fly    11 NGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREEL 75

Mouse    81 FITTKLWCTCFRPELVKPALEKSLKKLQLDYVDLYIMHYPVPMK-SGDNDFPVNEQGKSLLD-TV 143
            ||.||:.....||..|:|.::|||:.|||||||||::|.|..:. :.|..|.::::|...:| |.
  Fly    76 FIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVTT 140

Mouse   144 DFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKPGLKYKPVCNQVECHLYLNQRKLLDYCE 208
            :....|..:|...:.||.||||||||:..|:.|:|.  ..|.:|..||:|.|:||.||.|:|:|:
  Fly   141 NHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDLVDFCK 203

Mouse   209 SKDIVLVAYGALGTQRYKEW-----VDQNSPVLLNDPVLCDVAKKNKRSPALIALRYLIQRGIVP 268
            |::|.:.||..||::...::     :.::.|.|::.|.:.::|..:.::||.:.||::|..|:..
  Fly   204 SENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVSA 268

Mouse   269 LAQSFKENEMRENLQVFGFQLSPEDMKTLDGLNKNFRYLPAEF---LVDHPEYPFVEEY 324
            :.:|.....:::||.||.|:|:.|::..|..|::|.|.....|   :..|||:.|..:|
  Fly   269 IPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQY 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Akr1c13XP_006516545.1 ARA1 42..308 CDD:223729 103/273 (38%)
Tas 42..298 CDD:223739 100/263 (38%)
CG2767NP_649757.1 ARA1 5..302 CDD:223729 107/293 (37%)
Tas 10..297 CDD:223739 105/288 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.