DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHIA and Mur89F

Sequence 1:NP_970615.2 Gene:CHIA HGNCID:17432 Length:476 Species:Homo sapiens
Sequence 2:NP_001262662.1 Gene:Mur89F FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster

Alignment Length:232 Identity:51/233 (22%)
Similarity:81/233 (35%) Gaps:57/233 (24%)


Human   274 SNPSNTGIGAPTSGAGPA--------------GPYAKESGIWAYYEICTFLKNGATQGWDAPQEV 324
            ||.:|.|..:.:|.:..:              |.:..:....|.:..|.....|   |::.   |
  Fly  1177 SNNNNQGSSSSSSSSSSSTSSKPNPSETCKVNGQFIGDRSDCAKFYRCVDNDRG---GFNM---V 1235

Human   325 PYAY-QGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAI----DLDDFTGTFCNQGKFPLISTLK 384
            |::. .|.||         |.:.|...|       .||:    .:...|.:.....:....||.:
  Fly  1236 PFSCGPGTVW---------DAQMQACNH-------AWAVKECGGIAPPTTSTPTTSRPTTASTSR 1284

Human   385 KALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGS-----SGGSGFCAVRANGLYPVANNR 444
            .:....::..|.|.....|:||.|:.|...:.|||...|     ....|.|  |:.|.....||.
  Fly  1285 PSDQTSTSRPTGPPTTARPVTARPTTSSPTTASSSQTTSPVTQAPNTDGKC--RSEGFMADPNNC 1347

Human   445 NAFWHCV-------NGVTYQQNCQAGLVFDTSCDCCN 474
            :.|:.||       ..:.:|  |.||.|:|.....||
  Fly  1348 SKFYRCVRNNKGGFTSIPFQ--CGAGTVWDQDLQTCN 1382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHIANP_970615.2 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 23/132 (17%)
Glyco_18 26..365 CDD:214753 20/110 (18%)
Chitooligosaccharide binding. {ECO:0000305} 70..71
Chitooligosaccharide binding. {ECO:0000305} 97..100
Chitooligosaccharide binding. {ECO:0000305} 210..213
ChtBD2 429..476 CDD:214696 16/54 (30%)
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884 15/77 (19%)
CBM_14 1336..1388 CDD:279884 15/50 (30%)
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.