DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ZNF777 and CG6654

Sequence 1:XP_005250037.1 Gene:ZNF777 HGNCID:22213 Length:875 Species:Homo sapiens
Sequence 2:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster

Alignment Length:588 Identity:162/589 (28%)
Similarity:236/589 (40%) Gaps:138/589 (23%)


Human   345 NLSEWQKELYKNVMRGNYESLVSMDYAISKPDLMSQMERGE--RPTMQEQEDSEEGETPTDPSAA 407
            |.|...::|..|.:....:|.||:...::..|...|....|  |.|...|.|:   .|.||....
  Fly    71 NSSRTLRQLLPNALPEEPDSKVSISCPVATTDQAVQTTSWEPDRCTASVQTDA---VTTTDAEQN 132

Human   408 HDGIVIKIEVQTNDEGSESLETPEPLMGQVEEHGFQDSELGDPCGEQPDLDMQEPENTLEEST-- 470
            ...|...|.|..:.||.          |:|.::...|    :|..:...|.:|...|..:|..  
  Fly   133 TSLIKSTISVDLDYEGE----------GEVFDYELPD----EPVEKTTSLILQVQGNLKDEKEVV 183

Human   471 --------EGSSEFSELKQMLVQQRNCT----EGI----------------------VIKTEEQD 501
                    ||...  ||:|   |.|.|.    ||:                      ::..:|.|
  Fly   184 FTQTNVIYEGDDH--ELEQ---QIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQEND 243

Human   502 ---------EEEEEEEEDELPQHLQSLGQLSGRYEASMYQTPLPGEMSPEGEESPPPLQLGNPAV 557
                     ||..|.|::::||..:...:..|..:..:..|| |.:..|    ||...:||.   
  Fly   244 KHQTPVGSKEEARELEKEQVPQSAKRTSRRRGVVKQDVPATP-PSDAEP----SPKQHRLGT--- 300

Human   558 KRLAPSVHGERHLSENR-----GASSQQQRNRRGERPFTCMECGKSFRLKINLIIHQRNHIKEG- 616
                     :|.||..|     |.|:........|..:.|..|...|.::.:|:||:|   ::| 
  Fly   301 ---------QRKLSAPRAGTVNGPSTTSGAATTPELKYHCDRCNAGFAVEKSLMIHRR---QKGC 353

Human   617 ---PYECAECEISFRHKQQLTLHQRIHRVRGGCVSPERGPTFNPKHALKPRPKSPSSGSGGGGPK 678
               .|:|.|||..|.....|..||..|..                                    
  Fly   354 INRNYKCNECEKVFVSPDHLAEHQASHGA------------------------------------ 382

Human   679 PYKCPECDSSFSHKSSLTKHQIT-HTGERPYTCPECKKSFRLHISLVIHQRVHAGKHEVSFICSL 742
             :.||||......|.:|:||.:. |.......|..|:|.|.:..:|..|.|:|.|  |..|:|::
  Fly   383 -HNCPECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTG--EKPFVCNI 444

Human   743 CGKSFSRPSHLLRHQRTHTGERPFKCPECEKSFSEKSKLTNHCRVHSRERPHACPECGKSFIRKH 807
            |||||::.::|.:|:..|:..:.|||..|..||..|::||:|.|.|:.::|..|..|...|....
  Fly   445 CGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSC 509

Human   808 HLLEHRRIHTGERPYHCAECGKRFTQKHHLLEHQRAHTGERPYPCTHCAKCFRYKQSLKYHLRTH 872
            .|.:|:|.|||||||.|..|..|||..:.|..|:|.|||||||.|..|:|.|..:...:.|.|||
  Fly   510 SLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTH 574

Human   873 TGE 875
            .||
  Fly   575 QGE 577

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZNF777XP_005250037.1 KRAB 329..387 CDD:214630 11/44 (25%)
KRAB_A-box 329..368 CDD:143639 7/23 (30%)
zf-C2H2 590..612 CDD:278523 7/22 (32%)
C2H2 Zn finger 592..612 CDD:275368 7/20 (35%)
zf-H2C2_2 604..629 CDD:290200 11/29 (38%)
C2H2 Zn finger 620..640 CDD:275368 8/20 (40%)
CpXC 681..>730 CDD:291051 16/50 (32%)
C2H2 Zn finger 682..702 CDD:275368 8/21 (38%)
COG5048 <684..870 CDD:227381 73/187 (39%)
zf-H2C2_2 694..717 CDD:290200 7/24 (29%)
C2H2 Zn finger 713..730 CDD:275370 6/17 (35%)
zf-C2H2 738..760 CDD:278523 9/22 (41%)
C2H2 Zn finger 740..760 CDD:275368 8/20 (40%)
zf-H2C2_2 752..776 CDD:290200 9/24 (38%)
C2H2 Zn finger 768..788 CDD:275368 9/20 (45%)
zf-H2C2_2 781..805 CDD:290200 9/24 (38%)
C2H2 Zn finger 796..816 CDD:275368 6/20 (30%)
zf-H2C2_2 808..833 CDD:290200 15/25 (60%)
C2H2 Zn finger 824..844 CDD:275368 8/20 (40%)
zf-H2C2_2 836..861 CDD:290200 14/25 (56%)
C2H2 Zn finger 852..872 CDD:275368 7/20 (35%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 2/8 (25%)
C2H2 Zn finger 331..354 CDD:275368 8/26 (31%)
COG5048 <357..570 CDD:227381 84/252 (33%)
C2H2 Zn finger 360..380 CDD:275368 8/20 (40%)
C2H2 Zn finger 385..406 CDD:275370 8/21 (38%)
C2H2 Zn finger 414..434 CDD:275368 7/20 (35%)
zf-H2C2_2 427..451 CDD:290200 13/26 (50%)
C2H2 Zn finger 442..490 CDD:275368 20/48 (42%)
C2H2 Zn finger 470..487 CDD:275368 8/17 (47%)
zf-H2C2_2 482..507 CDD:290200 9/25 (36%)
C2H2 Zn finger 498..518 CDD:275368 6/20 (30%)
zf-H2C2_2 510..534 CDD:290200 14/24 (58%)
C2H2 Zn finger 526..546 CDD:275368 8/20 (40%)
zf-H2C2_2 539..563 CDD:290200 14/24 (58%)
C2H2 Zn finger 554..574 CDD:275368 7/20 (35%)
C2H2 Zn finger 582..602 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.