DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ZBTB11 and CG31365

Sequence 1:NP_055230.2 Gene:ZBTB11 HGNCID:16740 Length:1053 Species:Homo sapiens
Sequence 2:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster

Alignment Length:736 Identity:156/737 (21%)
Similarity:251/737 (34%) Gaps:227/737 (31%)


Human   151 ESEDDLSNFTSSPTTASKPAKKKPVSKHELVFVDTKGVVKRSSPKH-CQAVLKQLNEQRLSNQFC 214
            |.:|..:.|....|..|     .||.....|.:|.|..  .:.||. ||....||.:..|..|.|
  Fly    20 EHQDAYAIFDEDDTQLS-----IPVRLMACVALDAKAT--DTLPKRICQECRYQLEKSFLFRQRC 77

Human   215 DVTLLIEGEEYKAHKSV----LSANSEYFR---DLFIEKGAVSSHEAVVDLSGFCKASFLPLLEF 272
                  :..|.|..|.:    |...|..|.   |.:.|.                        |.
  Fly    78 ------QWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDED------------------------EL 112

Human   273 AYTSVLSFDFCSMADVAILARHLFMSEVLEICESVHKLMEEKQLTVYKKGEV-----QTVASTQD 332
            .:...::|                    :|:.:.|.||.:||....:|:.:.     :.|.|..:
  Fly   113 EFEDSIAF--------------------IEVQDKVRKLEDEKWREDFKEEQAAEMHKRLVKSRLE 157

Human   333 LRVQNGGTAPPVASSEGTTTSLPTELGDCEIVLLVNGELPEAEQN-------------------- 377
            ||.:             .||.|..||.: |:...|..||.|..::                    
  Fly   158 LRAK-------------LTTELRKELAE-EVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQLA 208

Human   378 ---GEV----------------GRQPE--PQVSSEAESALSSVGCIADSHPEMESVDL------- 414
               ||:                |.:||  |||..:|..:.|....:....|.:...:|       
  Fly   209 MLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARK 273

Human   415 ITKNNQTELETSNNRENNTVSNIHPKLSKENVISSSPED----SGMGNDI--------------S 461
            ..|..:..|..:.:..||:..||......|.|.:.|.||    :.:|:|:              |
  Fly   274 DAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSAS 338

Human   462 AEDICAEDIPKHRQKVDQPLKDQENLVASTAKTDFGPDDDTYRSRLRQRSVNEGAYIRLHKGMEK 526
            :||...:..|:.         ||:|.:.|                   .::.|...|:...    
  Fly   339 SEDQNQDSTPEF---------DQDNGITS-------------------YNIKEDGEIQFSG---- 371

Human   527 KLQKRKAVPKSAVQQVAQKLVQRGKK---------MKQPKRDAKENTEEASHKCGECGMVFQRRY 582
              :|.:.:....|..:.:::.|..:.         :::.:.|..|.|.....:..|  :||::..
  Fly   372 --EKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSE--LVFKQES 432

Human   583 ALIMHKLKH--ERARDYKCPLCKKQFQYSASLRAHLIRHTRKDAPSSSSSNSTSNEASGTSSEKG 645
            :....|...  :..:.::|.||...|.....|..|...|.:                 |..|.||
  Fly   433 SCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIK-----------------GLKSGKG 480

Human   646 RTKREFICSICGRTLPKLYSLRIHMLKHTGVKPHACQVCGKTFIYKHGLKLHQSLHQSQKQFQCE 710
            .|.:   |..|...|....||:.||:.|||:||..|..|..:|..:..||.|...|...|:.||.
  Fly   481 GTLK---CPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCP 542

Human   711 LCVKSFVTKRSLQEHMS-IHTGESK-YLCSVCGKSFHRGSGLSKHFKKHQPKPEVRG--YHCTQC 771
            .|...|..|.:||:|:. :|.|.|: :.|.:|.:||:..||||:|...|      .|  :.|.||
  Fly   543 QCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTH------AGVMFSCKQC 601

Human   772 EKSFFEARDLRQHMNKHLGVK 792
            .:.|.:...:::|:.....||
  Fly   602 GRQFNDRSAVQRHVTTMHKVK 622

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZBTB11NP_055230.2 BTB 204..305 CDD:279045 15/108 (14%)
BTB 215..306 CDD:197585 11/98 (11%)
C2H2 Zn finger 571..591 CDD:275368 4/20 (20%)
C2H2 Zn finger 599..619 CDD:275368 6/20 (30%)
C2H2 Zn finger 653..673 CDD:275368 7/20 (35%)
zf-H2C2_2 665..690 CDD:290200 12/25 (48%)
C2H2 Zn finger 681..701 CDD:275368 6/20 (30%)
C2H2 Zn finger 709..729 CDD:275368 7/21 (33%)
zf-H2C2_2 721..746 CDD:290200 10/27 (37%)
C2H2 Zn finger 737..757 CDD:275368 9/20 (45%)
C2H2 Zn finger 768..788 CDD:275368 5/20 (25%)
zf-H2C2_2 780..804 CDD:290200 3/14 (21%)
C2H2 Zn finger 796..816 CDD:275368
C2H2 Zn finger 860..880 CDD:275368
C2H2 Zn finger 888..908 CDD:275368
zf-H2C2_2 900..923 CDD:290200
C2H2 Zn finger 916..937 CDD:275368
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 21/79 (27%)
vATP-synt_E 109..>244 CDD:304907 32/193 (17%)
RRF <161..222 CDD:294170 12/75 (16%)
zf-C2H2_8 454..530 CDD:292531 28/96 (29%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 9/20 (45%)
C2H2 Zn finger 598..617 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.