DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GBX2 and unpg

Sequence 1:NP_001476.2 Gene:GBX2 HGNCID:4186 Length:348 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:437 Identity:147/438 (34%)
Similarity:182/438 (42%) Gaps:133/438 (30%)


Human     7 PSLMMMQRPLGSSTAFSIDSLI-------GSPPQP----------------------SPGHFVYT 42
            |:..:..:|.  ...|||:|||       .:||.|                      :......|
  Fly    18 PTTRLASKPF--PKPFSIESLIANQTPATATPPSPPEERDQEQEAEQEQELSARAMVASSALGLT 80

Human    43 GYPMFMPY---------------------------------RPVVLPPPPPPPPALPQAALQPAL 74
            .:|::.|:                                 :|.....|.||||..|..||:..|
  Fly    81 QFPLYNPWLHGYFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQL 145

Human    75 PPAHPHHQIPSLPTGFC--SSLAQGMA---LTSTLMATLPG-------GFSASPQHQEAAAARKF 127
            ||..||    .|.|.|.  :..|.|:|   |:...:|.|..       ...|..||. |||.|..
  Fly   146 PPTLPH----PLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHM-AAAGRMH 205

Human   128 APQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDP 192
            ..|..||.....:....||.:..     ||.||......|..|                      
  Fly   206 EDQANPGMAQLQEPTPPQAHSSP-----AKSGSHSPMEPALDV---------------------- 243

Human   193 KGKEESFSLESDV-----------DYSSDDNLTGQAAHKEEDPGHALEETPPSS----GAAGSTT 242
             |.:|.|....|.           :|:.:.:.:...|:...|.....::....|    |..|...
  Fly   244 -GMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKD 307

Human   243 STG-------KNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRA 300
            |.|       |:||||||||||||||||:|||.|||||||||||||.:|||||||||||||||||
  Fly   308 SQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRA 372

Human   301 KWKRVKAGNANSKTGE--PSRNPKIVVPIPVHVSRFAIRSQHQQLEQ 345
            ||||||||..:...|.  .:...||||||||||:|||:||||||||:
  Fly   373 KWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEK 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GBX2NP_001476.2 Homeobox 250..303 CDD:306543 49/53 (92%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 47/51 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260501862
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I3994
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002838
OrthoInspector 1 1.000 T609124
orthoMCL 1 0.900 OOG5_136883
Panther 1 1.100 O PTHR24334
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4817
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.