DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GBX1 and Antp

Sequence 1:NP_001092304.1 Gene:GBX1 HGNCID:4185 Length:363 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:340 Identity:87/341 (26%)
Similarity:126/341 (37%) Gaps:77/341 (23%)


Human    39 GHLLYTGYPMF--MPY----------------RP--------LVLPQALAPAPLPAGLP------ 71
            |::.|..:|.:  |||                ||        .|:|||.....|  |:|      
  Fly    53 GNMPYPRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQL--GVPQQQQQQ 115

Human    72 PLAPLASFAGRLTNTFCAGLGQAVPSMVALTTALPSFAEPPDAFYGPQELAAAAAAAAATAARNN 136
            ...|..:...:........|.|.:|.:....|. |...:.....|...:|.||....        
  Fly   116 QQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTH-PQQQQQQPVVYASCKLQAAVGGL-------- 171

Human   137 PEPGGRRPEGGLE--ADEL----LPAREKVAEPPPPPPPHFSETFPSLPAEGKVYSSDEEK---L 192
                |..||||..  .|::    :.|:..:......|......|...:|...:|:.:....   .
  Fly   172 ----GMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQ 232

Human   193 EASAGDPAGSEQE---EEGSGGDSEDDGFLDSSAGGPGALLGPKPKLKGSLGTGAEEGAPVTAGV 254
            :.|...|.|:..:   .:|.|......|.       ||....|... ..|..:|..  :|:...:
  Fly   233 QQSGVPPVGAPPQGMMHQGQGPPQMHQGH-------PGQHTPPSQN-PNSQSSGMP--SPLYPWM 287

Human   255 TAPGGKSRRR---RTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKW 316
            .:..||.:.|   |..:|..|.||||||||..:||:...|.:|||||.|:|.|:||||||||.||
  Fly   288 RSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 352

Human   317 KRIKAGNVSSRSGEP 331
            |:     .:...|||
  Fly   353 KK-----ENKTKGEP 362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GBX1NP_001092304.1 Homeobox 264..317 CDD:306543 33/56 (59%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.