DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTPN22 and PTP-ER

Sequence 1:NP_057051.3 Gene:PTPN22 HGNCID:9652 Length:807 Species:Homo sapiens
Sequence 2:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster

Alignment Length:509 Identity:115/510 (23%)
Similarity:165/510 (32%) Gaps:236/510 (46%)


Human    11 LDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPK---NIKKNRYKDILPYDYSRVE 72
            |.|.:.|:|.: :...||..|             |....|||.   :..|||||.|||.:.|||.
  Fly   883 LKENEQKRIFR-DLHKEFWDL-------------PLNHQEKPMVFGSQTKNRYKTILPNENSRVL 933

Human    73 L-----------------SLITSDEDSSYINANFIKGV-YGPKAYIATQGPLSTTLLDFWRMIWE 119
            |                 |.:|:.||..|||||:|||. |..|.|:||||||..|:.:||.||::
  Fly   934 LESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSKCYVATQGPLPNTIFEFWLMIYQ 998

Human   120 YSVLI---------------------------IVMACMEYEMGKKKCERYW-------------- 143
            .:...                           |||.....|..::||..|:              
  Fly   999 NTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVYFPIELNEIFAVAAKC 1063

Human   144 ---------------------------AEPGEMQLEFGPFSVSCEAEK----------------- 164
                                       |....:..|.....:..|:.|                 
  Fly  1064 EVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVESVKVTLEGDLLEALPAQGSF 1128

Human   165 ---------RKSDYIIRTLKVKF--------NSETRTIYQFH--YKNWPDHDVPSSIDPILEL-- 208
                     |::.|.:|.|.:.:        :...:.||.:|  |.:||||..|..|:.:|:.  
  Fly  1129 FLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWYPDWPDHHSPRDINTLLDTCL 1193

Human   209 -------------IWD--------------VRCYQED-----DSVPICIHCSAGCGRTGVICAI- 240
                         |:|              :..||:|     ..:|: ||||||.||||...|| 
  Fly  1194 HVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQPLPV-IHCSAGIGRTGCFTAIL 1257

Human   241 ------------DYTWMLLK--------------------------------------------- 248
                        ..|.||.|                                             
  Fly  1258 NAVRQLRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSSFTCNTIRHISHILDHRDAEAVKTPPS 1322

Human   249 -DGI--IPENF-SVFSLIREMRTQRPSLVQTQEQYELVYNAVLELFKRQMDVIR 298
             |.:  :|:.| .|..::..:|.||..:||..|||||::.|:....||.:.:.|
  Fly  1323 FDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIHRAICLYLKRTLALRR 1376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTPN22NP_057051.3 PTPc 24..288 CDD:214550 108/485 (22%)
PTPc 56..288 CDD:238006 101/450 (22%)
Substrate binding 227..233 5/6 (83%)
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 101/449 (22%)
PTPc 917..1364 CDD:238006 101/448 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.