DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31778 and cutlet

Sequence 1:NP_001285596.1 Gene:CG31778 FlyBaseID:FBgn0051778 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_787969.1 Gene:cutlet FlyBaseID:FBgn0015376 Length:993 Species:Drosophila melanogaster

Alignment Length:33 Identity:10/34 (29%)
Similarity:15/34 (44%) Gaps:1/34 (3%)


  Fly    68 SNRKLFLTLEDCEKIC-NNPRHIKRRNQAKANE 99
            :||.|...|:..:|:. ....|.||..:|...|
  Fly   340 TNRSLLYWLKMWDKVVFGKAFHSKREQEAVTGE 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31778NP_001285596.1 KU 46..83 CDD:294074 5/15 (33%)
cutletNP_787969.1 AAA 424..555 CDD:99707
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1969
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.