| Sequence 1: | NP_722932.1 | Gene: | CG31778 / 261616 | FlyBaseID: | FBgn0051778 | Length: | 102 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001426422.1 | Gene: | Chtf18 / 214901 | MGIID: | 2384887 | Length: | 970 | Species: | Mus musculus |
| Alignment Length: | 32 | Identity: | 12/32 - (37%) |
|---|---|---|---|
| Similarity: | 13/32 - (40%) | Gaps: | 3/32 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 21 LEQPFTAEAVVRDACQTAPNKSVWLCSPSTLG 52 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31778 | NP_722932.1 | Kunitz-type | 46..83 | CDD:444694 | 4/7 (57%) |
| Chtf18 | NP_001426422.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 251..270 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 319..341 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 857..890 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||