DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31778 and Chtf18

DIOPT Version :10

Sequence 1:NP_722932.1 Gene:CG31778 / 261616 FlyBaseID:FBgn0051778 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_001426422.1 Gene:Chtf18 / 214901 MGIID:2384887 Length:970 Species:Mus musculus


Alignment Length:32 Identity:12/32 - (37%)
Similarity:13/32 - (40%) Gaps:3/32 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LEQPFTAEAVVRDACQTAPNKSVWLCSPSTLG 52
            ||:...||.   |..|....|...||.|..||
Mouse   347 LEEMLEAEL---DPSQRPRQKVALLCGPPGLG 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31778NP_722932.1 Kunitz-type 46..83 CDD:444694 4/7 (57%)
Chtf18NP_001426422.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..270
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..341
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 857..890
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.