powered by:
Protein Alignment CG31778 and Chtf18
DIOPT Version :9
| Sequence 1: | NP_001285596.1 |
Gene: | CG31778 / 261616 |
FlyBaseID: | FBgn0051778 |
Length: | 102 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_006524080.1 |
Gene: | Chtf18 / 214901 |
MGIID: | 2384887 |
Length: | 970 |
Species: | Mus musculus |
| Alignment Length: | 32 |
Identity: | 12/32 - (37%) |
| Similarity: | 13/32 - (40%) |
Gaps: | 3/32 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 21 LEQPFTAEAVVRDACQTAPNKSVWLCSPSTLG 52
||:...||. |..|....|...||.|..||
Mouse 347 LEEMLEAEL---DPSQRPRQKVALLCGPPGLG 375
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG31778 | NP_001285596.1 |
KU |
46..83 |
CDD:294074 |
4/7 (57%) |
| Chtf18 | XP_006524080.1 |
PRK04195 |
343..>589 |
CDD:235250 |
12/32 (38%) |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1969 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.