DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31778 and chtf18

Sequence 1:NP_001285596.1 Gene:CG31778 FlyBaseID:FBgn0051778 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_002935905.2 Gene:chtf18 XenbaseID:XB-GENE-987602 Length:1002 Species:Xenopus tropicalis

Alignment Length:35 Identity:13/36 (36%)
Similarity:14/36 (39%) Gaps:3/36 (8%)


  Fly    18 AVILEQPFTAEAVVRDACQTAPNKSVWLCSPSTLG 52
            |.|.|:...||.   |......||...||.|..||
 Frog   371 AQITEEILEAEL---DQHNRPKNKVALLCGPPGLG 402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31778NP_001285596.1 KU 46..83 CDD:294074 4/8 (50%)
chtf18XP_002935905.2 AAA 375..543 CDD:99707 11/32 (34%)
AAA 389..522 CDD:214640 7/15 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1969
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.