DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coq4 and coq4

Sequence 1:NP_001246815.1 Gene:Coq4 FlyBaseID:FBgn0052174 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001016225.1 Gene:coq4 XenbaseID:XB-GENE-5888837 Length:280 Species:Xenopus tropicalis

Alignment Length:261 Identity:122/262 (47%)
Similarity:166/262 (63%) Gaps:8/262 (3%)


  Fly     7 RLQKPLALRRGLRLAQANSQAVATEAPEAEPLDAFERQ-----YLKERIEISPFQRLFLGAGSSI 66
            |:.:|.|  .|::..:..|...|.|..|.|...|..||     ...:.|..:..|:|.|.|||::
 Frog    15 RVLRPAA--PGMQGGRFRSNYAAEEGIEEEIQFAAARQEDPSSLYSDHIPTNAVQKLLLSAGSAV 77

  Fly    67 AALLNPRRHDMIACLGETTGEDALWTILDTMQASEEGQRIMADKPRIHTSTIDFKYLETLPPDTF 131
            .||.:|.||||:|.||||||..||..:.|.|:...||.:|:.::|||..||:||:.|..:|..||
 Frog    78 MALYDPYRHDMVAVLGETTGAVALRKLRDQMRRDPEGLQILQERPRIRMSTLDFQTLREMPDGTF 142

  Fly   132 GAAYVKFLKDNQVTPDSRMAVRFLEDPKLAYLMTRYRECHDLIHTVLDMPTNMLGEVAVKWVEAL 196
            |..|.:||..|.||||:||.|:|::|.:|||:..||||.|||:||:|.|||||||||.|||.||:
 Frog   143 GREYARFLDVNHVTPDTRMPVKFVDDEELAYVAQRYREVHDLMHTLLGMPTNMLGEVVVKWFEAV 207

  Fly   197 NTGLPMCYGGAVFGAVRLRPKQRRAYLKHYLPWALENGKRTKPLMPVYWEKRWEQNIHELRSELG 261
            .||||||..||.||.:||..| |...|...:|||:::|:..:.::..|:||||.|::..||.|:|
 Frog   208 QTGLPMCILGAAFGPLRLNNK-RMKKLGVLVPWAVQSGRNARCVLNFYYEKRWGQSVASLREEIG 271

  Fly   262 I 262
            |
 Frog   272 I 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Coq4NP_001246815.1 Coq4 54..265 CDD:282826 109/210 (52%)
coq4NP_001016225.1 Coq4 66..276 CDD:282826 109/209 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C186663081
eggNOG 1 0.900 E1_COG5031
Hieranoid 1 1.000
Homologene 1 1.000 H68641
Inparanoid 1 1.050 227 1.000 Inparanoid score I3283
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003763
OrthoInspector 1 1.000 T1061019
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R234
TreeFam 1 0.960
1110.790

Return to query results.
Submit another query.