DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coq4 and coq4

Sequence 1:NP_001246815.1 Gene:Coq4 FlyBaseID:FBgn0052174 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_593130.1 Gene:coq4 PomBaseID:SPAC1687.12c Length:272 Species:Schizosaccharomyces pombe

Alignment Length:215 Identity:90/216 (42%)
Similarity:138/216 (64%) Gaps:2/216 (1%)


  Fly    50 IEISPFQRLFLGAGSSIAALLNP-RRHDMIACLGETTGED-ALWTILDTMQASEEGQRIMADKPR 112
            :.:||.||:||.|||:|..|..| |..|||:.||:.:|:. .|..:|:.|...:.|:.|:.||||
pombe    51 VPLSPLQRIFLVAGSAIMGLKAPWRGGDMISVLGDASGQPFFLHRLLNKMLVDKTGREILKDKPR 115

  Fly   113 IHTSTIDFKYLETLPPDTFGAAYVKFLKDNQVTPDSRMAVRFLEDPKLAYLMTRYRECHDLIHTV 177
            :.:.:::..:|.||||:|.|..||.::....|.||:|...||::||:.||:|.||||.||..|.:
pombe   116 MTSKSLNLPFLRTLPPNTLGKIYVDWIDKEHVGPDTRSPTRFVDDPEEAYVMQRYRESHDFYHAI 180

  Fly   178 LDMPTNMLGEVAVKWVEALNTGLPMCYGGAVFGAVRLRPKQRRAYLKHYLPWALENGKRTKPLMP 242
            .:||||:.||:|:||:|.:|.|||:....|:||.:||..:|...:.:.|:||::.||...|.|:.
pombe   181 CNMPTNIEGELAIKWLEFVNMGLPVGALSALFGPLRLNCEQASRFRRVYIPWSIRNGLNAKTLIN 245

  Fly   243 VYWEKRWEQNIHELRSELGI 262
            |||||....:|.::|..:.|
pombe   246 VYWEKELTNDIEDVRRRIRI 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Coq4NP_001246815.1 Coq4 54..265 CDD:282826 89/212 (42%)
coq4NP_593130.1 Coq4 55..269 CDD:282826 89/212 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H68641
Inparanoid 1 1.050 184 1.000 Inparanoid score I1081
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003763
OrthoInspector 1 1.000 T1125711
orthoMCL 1 0.900 OOG5_128661
Panther 1 1.100 LDO PTHR12922
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R234
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.