DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coq4 and coq4

Sequence 1:NP_001246815.1 Gene:Coq4 FlyBaseID:FBgn0052174 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_017211501.1 Gene:coq4 ZFINID:ZDB-GENE-060526-218 Length:275 Species:Danio rerio

Alignment Length:224 Identity:107/225 (48%)
Similarity:146/225 (65%) Gaps:0/225 (0%)


  Fly    39 DAFERQYLKERIEISPFQRLFLGAGSSIAALLNPRRHDMIACLGETTGEDALWTILDTMQASEEG 103
            :.::.:.....|..|..|:..|..||.:|||.||.||||:|.||||||...|..:.|.|:...||
Zfish    31 EKYDGRLYPSHIPTSTVQKAILAVGSGVAALKNPYRHDMVAVLGETTGHQTLIKLRDRMRNDPEG 95

  Fly   104 QRIMADKPRIHTSTIDFKYLETLPPDTFGAAYVKFLKDNQVTPDSRMAVRFLEDPKLAYLMTRYR 168
            ..|:.::|||..||:|...:..||..|.|..|::||::|:||||:|..|:|:::.:|||:|.|||
Zfish    96 STILLERPRIRLSTLDLSNMSALPDGTLGREYLRFLEENRVTPDTRAEVKFVDNEELAYVMQRYR 160

  Fly   169 ECHDLIHTVLDMPTNMLGEVAVKWVEALNTGLPMCYGGAVFGAVRLRPKQRRAYLKHYLPWALEN 233
            |.|||:||:|.|||||||||||||.||..||||||..||..|.:||...:.:...:....|||.|
Zfish   161 EVHDLLHTLLGMPTNMLGEVAVKWFEAAQTGLPMCILGAALGPLRLSVSRLQLLGQSLGLWALRN 225

  Fly   234 GKRTKPLMPVYWEKRWEQNIHELRSELGI 262
            |.|.:.::.:|:|:||||.:.|||.||.|
Zfish   226 GGRARCVLSIYYERRWEQTLDELRHELNI 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Coq4NP_001246815.1 Coq4 54..265 CDD:282826 105/210 (50%)
coq4XP_017211501.1 Coq4 46..258 CDD:282826 105/210 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C186665740
eggNOG 1 0.900 E1_COG5031
Hieranoid 1 1.000
Homologene 1 1.000 H68641
Inparanoid 1 1.050 221 1.000 Inparanoid score I3460
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003763
OrthoInspector 1 1.000 T1054226
orthoMCL 1 0.900 OOG5_128661
Panther 1 1.100 LDO PTHR12922
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R234
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.