DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19b and Or98b

DIOPT Version :8

Sequence 1:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster

Alignment Length:430 Identity:74/431 (17%)
Similarity:147/431 (34%) Gaps:126/431 (29%)


  Fly    18 IFRIMGI-----HPPGKRTFWGRHYTAYSMVWNVTFHICIWVSFSVNLLQSNSLETFCESLCVTM 77
            :||::|:     ...|.|..|    .:...:.:|...:.:.::|.:..:|  ::|...:|||..:
  Fly    13 LFRLLGLELLHEQDVGHRYPW----RSICCILSVASFMPLTIAFGLQNVQ--NVEQLTDSLCSVL 71

  Fly    78 PHTLYMLKLINVRRMRGEMISSHWLLR-----------LLDKRLGCADERQIIMAGIERAEFI-- 129
            ...|.:.|:       |..:   ||.:           :|......|....|:.....|.:||  
  Fly    72 VDLLALCKI-------GLFL---WLYKDFKFLIGQFYCVLQTETHTAVAEMIVTRESRRDQFISA 126

  Fly   130 ---FRTIFRGL-ACTVVLGIIYIS----ASSEPTLMYPTWIPWNWKDSTSAYLATAMLHTTALMA 186
               :..|..|| ||.:....:.||    ...:|...:|:..||:                     
  Fly   127 MYAYCFITAGLSACLMSPLSMLISYQRTGELQPKFPFPSVYPWD--------------------- 170

  Fly   187 NATLVLNLSSYPGTYLILVSVHTKALALRVSKLGYGAPLPAVRMQAILVGYIHD----------- 240
                .:.||:|      ::|......|      ..|..||.|.:..:.....|:           
  Fly   171 ----NMKLSNY------IISYFWNVCA------ALGVALPTVCVDTLFCSLSHNLCALFQIARHK 219

  Fly   241 ------------HQIILRLFKSLERSLSMTCFL---------QFFSTACAQCTICYFLLFGNVGI 284
                        |:.:..:|:.....|::..||         ||.:.:...|.:||.|   :..|
  Fly   220 MMHFEGRNTKETHENLKHVFQLYALCLNLGHFLNEYFRPLICQFVAASLHLCVLCYQL---SANI 281

  Fly   285 MRFMNMLF---LLVILTTETLLLCYTAELPCKEGESLLTAVYSCNW---LSQSVNFRRLLLLMLA 343
            :: ..:||   ....:..:..:.|:.......|.:....|:|..:|   |.:::.....|.:.:.
  Fly   282 LQ-PALLFYAAFTAAVVGQVSIYCFCGSSIHSECQLFGQAIYESSWPHLLQENLQLVSSLKIAMM 345

  Fly   344 RCQI--PMILVSGVIVPISMKTFTVMIKGAYTMLTLLNEI 381
            |..:  |   :.|.....:.:|...:::.|.:.:|||..:
  Fly   346 RSSLGCP---IDGYFFEANRETLITIVRTAISYVTLLRSL 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 62/368 (17%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 61/367 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.