DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19b and Or88a

DIOPT Version :9

Sequence 1:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:267 Identity:52/267 - (19%)
Similarity:103/267 - (38%) Gaps:48/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 CTVVLGIIYISASSEPT------LMYPTWIPWNWKDSTSAYL---ATAMLHTTALMANATLVLNL 194
            |.|.|.:..::...:.|      .:...|:|...:...:.||   :..::.||..::......||
  Fly   153 CVVPLALFLLTHEGKDTPVAQHEQLLGGWLPCGVRKDPNFYLLVWSFDLMCTTCGVSFFVTFDNL 217

  Fly   195 SSYPGTYLILVSVHTKALALRVSKLGYGAPLP-----------AVRMQAILVGYIHDHQIILRLF 248
            .:....:|::   |...||.:.|.:.....|.           .|:.|.:|.|....:..|.:: 
  Fly   218 FNVMQGHLVM---HLGHLARQFSAIDPRQSLTDEKRFFVDLRLLVQRQQLLNGLCRKYNDIFKV- 278

  Fly   249 KSLERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIMRFMNMLFLLVILTTETLLLCYTAELPC- 312
                      .||  .|......::|::|..    :....::|.:...:....:|:.:|.|: | 
  Fly   279 ----------AFL--VSNFVGAGSLCFYLFM----LSETSDVLIIAQYILPTLVLVGFTFEI-CL 326

  Fly   313 ------KEGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGA 371
                  |..|.|.:::.|..|...|..:|:..||....||....|.:..::.::|..||.:::.|
  Fly   327 RGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHFTEIMQLA 391

  Fly   372 YTMLTLL 378
            |.:.|.|
  Fly   392 YRLFTFL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 48/259 (19%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 48/259 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465879
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.