DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19b and Or85b

DIOPT Version :8

Sequence 1:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster

Alignment Length:414 Identity:85/415 (20%)
Similarity:155/415 (37%) Gaps:95/415 (23%)


  Fly    19 FRIMGIHPPGKRTFWGRHYT--AYSMVWNVTFHICIW-----VSFSVNLLQS---------NSLE 67
            :..:||.|          ||  ..|.:..:.|||..|     :|| |.|.:|         |...
  Fly    12 YTAVGIRP----------YTNGEESKMNKLIFHIVFWSNVINLSF-VGLFESIYVYSAFMDNKFL 65

  Fly    68 TFCESLCVTMPHTLYMLKLINVRRMR---GEMISS------HWLLRLLDKRLGCADER---QIIM 120
            ....:|......|:.|.|:..:|..:   .|:|:.      :.|:|         :||   .:.:
  Fly    66 EAVTALSYIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIR---------EERYNLPMYL 121

  Fly   121 AGIERAEFIFRTIFR------GLACTVVLGI------IYISASSEPTLMYPTWIPWNWKDSTSAY 173
            ....|...|:..::.      .|.|.:...:      |.:.....|.|||   |||.|:|:.|.|
  Fly   122 GTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMY---IPWKWQDNWSYY 183

  Fly   174 LATAMLHTTALMANATLVLNLSSYP------GTYLILVSVHTKALALRVSKLGYGAPLPAV---- 228
               .:|.:.          |.:.|.      .|.::|.:|.|: |.:....|........:    
  Fly   184 ---PLLFSQ----------NFAGYTSAAGQISTDVLLCAVATQ-LVMHFDFLSNSMERHELSGDW 234

  Fly   229 -RMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFG---NVGIMRFMN 289
             :....||..:..|:.||||..::.....:...|.|..::...|.:.:.:..|   ::.:..|: 
  Fly   235 KKDSRFLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPDIVVKLFL- 298

  Fly   290 MLFLLVILTTETLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMILVSG 354
               .||...::..|:|:..:|..........|.|:..|....|.::|.|::::||.|....|.:.
  Fly   299 ---FLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVTFLKAT 360

  Fly   355 VIVPISMKTFTVMIKGAYTMLTLL 378
            :.:.|:..|.|.:::.:|....||
  Fly   361 IFLDITRSTMTDLLQISYKFFALL 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 66/345 (19%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 66/344 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51198
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.