DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19b and Or83c

DIOPT Version :8

Sequence 1:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster

Alignment Length:387 Identity:86/388 (22%)
Similarity:144/388 (37%) Gaps:86/388 (22%)


  Fly    44 WNVTFHICIWVSFSVNLLQSN----------SLET------FCESLCVTMPH------TLYMLKL 86
            |...|.|..:..|:|..:.:|          ||.|      ..:.|...:.|      .||...:
  Fly    41 WTTIFAIANYTGFTVFTILNNGGDWRVGLKASLMTGGLFHGLGKFLTCLLKHQDMRRLVLYSQSI 105

  Fly    87 INVRRMRGEMISSHWLLRL-LDKRLGCADERQIIMAGIERAEFIFRTIFRGLACTVVLGIIYISA 150
            .:....||:  |.|..|.. :|:.||       ||. |.|..::|......|   :.|.::....
  Fly   106 YDEYETRGD--SYHRTLNSNIDRLLG-------IMK-IIRNGYVFAFCLMEL---LPLAMLMYDG 157

  Fly   151 SSEPTLMYPTWIPWNWKDSTSAYLATAMLHTTALMANATLVLNLSSYPG---TYLILVSVHTKA- 211
            :....:.|  .||....::...|:.|.|:.|..:     ||..:..|.|   .:|.|..:.|.| 
  Fly   158 TRVTAMQY--LIPGLPLENNYCYVVTYMIQTVTM-----LVQGVGFYSGDLFVFLGLTQILTFAD 215

  Fly   212 -LALRVSKLG--------------YGAPLP-AVRMQAILVGYIHDHQIILRLFKSLERSLSMTCF 260
             |.::|.:|.              .||.:. |...|.:|:..|..||    ||....|::: ..:
  Fly   216 MLQVKVKELNDALEQKAEYRALVRVGASIDGAENRQRLLLDVIRWHQ----LFTDYCRAIN-ALY 275

  Fly   261 LQFFSTACAQCTICYFLLFG-NVGIMRFMNMLFLLVILTTETLLLCYTAELPCKEGESLLTA--- 321
            .:..:|......:...|.|. |:......:.:|.:|        ..|:..:.|..|..|..|   
  Fly   276 YELIATQVLSMALAMMLSFCINLSSFHMPSAIFFVV--------SAYSMSIYCILGTILEFAYDQ 332

  Fly   322 VYS--CN--WLSQSVNFRRLLLLMLARCQIP-MILVSGVIVPISMKTFTVMIKGAYTMLTLL 378
            ||.  ||  |...|...|:|...:|...|.| .|.:.|| :.:|::|...::|..|::..::
  Fly   333 VYESICNVTWYELSGEQRKLFGFLLRESQYPHNIQILGV-MSLSVRTALQIVKLIYSVSMMM 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 79/349 (23%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 79/352 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50489
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.