DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19b and Or63a

DIOPT Version :9

Sequence 1:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:236 Identity:50/236 - (21%)
Similarity:88/236 - (37%) Gaps:33/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 MYPTW------IPWNWKDSTSAYLATAMLHTTALMANATLVLNLSSYPGTYLILVSVHTKALALR 215
            :||.|      .|:.   ....||.|..|:...:.|        .|:.|.:::| .:|:..|...
  Fly   194 LYPAWEHKGLEFPYY---HIQMYLETCSLYICGMCA--------VSFDGVFIVL-CLHSVGLMRS 246

  Fly   216 VSKLGYGAP---LPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQF------FSTACAQC 271
            ::::...|.   :|..|....|...|:.:|.:......:........|.||      :..|..|.
  Fly   247 LNQMVEQATSELVPPDRRVEYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWGLALFQM 311

  Fly   272 TICYFLLFGNVGIMRFMNMLFLLVILTTETLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRR 336
            ::.    .||...:..:.|...||....:.::.||..:......|.:..|.|...|..:|..||.
  Fly   312 SVG----LGNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESREFRH 372

  Fly   337 LLLLMLARCQIPMILVSGVIVPISMKTFTVMIK--GAYTML 375
            |:.:||.|......|.....:.:|:.|...|::  |.|.:|
  Fly   373 LIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 48/231 (21%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 47/229 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465172
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.