DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19b and Or43b

DIOPT Version :8

Sequence 1:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster

Alignment Length:452 Identity:105/453 (23%)
Similarity:187/453 (41%) Gaps:126/453 (28%)


  Fly    12 LVNHWRIFRIMGIHP-PGKRTFWGRHYTAYSM-------------------VWNV---TFHICIW 53
            :..|:::     ::| |.......|...||.|                   :|.|   |:::.|.
  Fly     1 MFGHFKL-----VYPAPISEPIQSRDSNAYMMETLRNSGLNLKNDFGIGRKIWRVFSFTYNMVIL 60

  Fly    54 -VSFSVN------------LLQSNS--LETFCESLCVTMPHTLYMLKLINVRRMRGEMISSHWLL 103
             |||.:|            ||||..  |.|:|.:|       .:...::...|:  |:.:.|:  
  Fly    61 PVSFPINYVIHLAEFPPELLLQSLQLCLNTWCFAL-------KFFTLIVYTHRL--ELANKHF-- 114

  Fly   104 RLLDKRLGC---ADERQI--IMAGIERAEFIFRTIFRGLACTVVLGIIYISASSEPTLM-----Y 158
            ..|||.  |   |::|::  ::|.|.|....|          ||:.::|.:::....|:     |
  Fly   115 DELDKY--CVKPAEKRKVRDMVATITRLYLTF----------VVVYVLYATSTLLDGLLHHRVPY 167

  Fly   159 PTWIPW-NWK-DSTSAYLATAMLHTTA----LMANATLVLNLSSYPGTYLILVSVHTKALALRVS 217
            .|:.|: ||: |.|..|:.:.:.:.|.    .:|.||     .|||..|:..:..|...|..|:.
  Fly   168 NTYYPFINWRVDRTQMYIQSFLEYFTVGYAIYVATAT-----DSYPVIYVAALRTHILLLKDRII 227

  Fly   218 KLG----YGAPLPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLL 278
            .||    .|:..|:...:: ||..|..|:.:|....:::..:|.|.|.||.        ||..:|
  Fly   228 YLGDPSNEGSSDPSYMFKS-LVDCIKAHRTMLNFCDAIQPIISGTIFAQFI--------ICGSIL 283

  Fly   279 FGNVGIM------------RFMNMLFLLVILTTETLLLCYTAEL---PCKEGESLLTAVYSCNWL 328
                ||:            ||..:::::.:| .:|..||:....   .|||   |..|::...|.
  Fly   284 ----GIIMINMVLFADQSTRFGIVIYVMAVL-LQTFPLCFYCNAIVDDCKE---LAHALFHSAWW 340

  Fly   329 SQSVNFRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTL---LNEIRKTSLE 387
            .|...::|.::..|.:.|.||...:..|..|::.|...:.|.|:|:..:   :|..:|.|::
  Fly   341 VQDKRYQRTVIQFLQKLQQPMTFTAMNIFNINLATNINVAKFAFTVYAIASGMNLDQKLSIK 402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 82/344 (24%)
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 79/334 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5163074
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.