DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19b and Or65b

DIOPT Version :8

Sequence 1:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster

Alignment Length:305 Identity:54/306 (18%)
Similarity:105/306 (34%) Gaps:104/306 (34%)


  Fly   128 FIFRTIFRGLACTVVLGIIYISASSEPTLMYPTWI-----------PWNWKDSTSAYLATAMLHT 181
            |...|.:....|.::|.:|          ..|.|:           |:.|.:.:        ||.
  Fly   147 FFLATSWSFFLCILLLLLI----------TSPMWVHQQNLPFHAAFPFQWHEKS--------LHP 193

  Fly   182 TALMANATLVLNLSSYPGTYL-----------------ILVSVHTKALALR-VSKLGYGAPLPAV 228
               :::|.:.| ..||...|.                 |...:....|.|| :.:..||  |..:
  Fly   194 ---ISHAIIYL-FQSYFAVYCLTWLLCIEGLSICIYAEITFGIEVLCLELRQIHRHNYG--LQEL 252

  Fly   229 RMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFGNV----------G 283
            ||:...:..:|.     ::.:.|:|:..:     |..|...|..:.:.|:..:|          .
  Fly   253 RMETNRLVKLHQ-----KIVEILDRTNDV-----FHGTLIMQMGVNFSLVSLSVLEAVEARKDPK 307

  Fly   284 IMRFMNMLFLLVI------------LTTETLLL---CYTAELPCKEGESLLTAVYSCNWLSQSVN 333
            ::....:|.||.:            |:.::|.:   .|.|..|.|..:.    ||          
  Fly   308 VVAQFAVLMLLALGHLSMWSYCGDQLSQKSLQISEAAYEAYDPTKGSKD----VY---------- 358

  Fly   334 FRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLL 378
              |.|.:::.|.|.|:|:.:......::..::.::...|.:||.|
  Fly   359 --RDLCVIIRRGQDPLIMRASPFPSFNLINYSAILNQCYGILTFL 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 50/298 (17%)
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 50/298 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51688
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.