DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment solo and ddx3x

DIOPT Version :8

Sequence 1:NP_001027274.2 Gene:solo / 26067079 FlyBaseID:FBgn0283440 Length:1031 Species:Drosophila melanogaster
Sequence 2:XP_017946633.1 Gene:ddx3x / 394804 XenbaseID:XB-GENE-999731 Length:744 Species:Xenopus tropicalis

Alignment Length:985 Identity:175/986 (18%)
Similarity:269/986 (27%) Gaps:441/986 (45%)


  Fly     9 PIVDTRGARGGDWSDDEDTAKSFSGEAEGDGVGGSGGEGGGY-QGGNRDVFGRIGGGRGGGAGGY 72
            |.||.....|..||...|        |..|    :|..|.|| .|.|.|...|:.|....|.|. 
 Frog    58 PAVDVYKGYGDWWSQRTD--------ANWD----AGRGGNGYVNGTNDDRDSRMNGYDRSGYGN- 109

  Fly    73 RGGNRDGGGFHGGRREGERDFRGGEGGFRGGQGGSRGGQGGSRGGQGGF--RGGEGGFRGRLYEN 135
            ||..|...||:      :|:..|...| |.....|..|..|.||....|  |||.|..|..|   
 Frog   110 RGSGRTDRGFY------DRENSGWNSG-RDKDAYSSFGSRGERGKPSLFNDRGGSGSRRVVL--- 164

  Fly   136 EDAKELPPIPSSCDKDEVGAFIDQLDLSKYTTSLALIRKLRDYLLTAFKALVNQAWASLEKLAQE 200
              ..||.|.|                     ..|.|:..||                     ..:
 Frog   165 --CSELAPWP---------------------LQLKLVNHLR---------------------PDD 185

  Fly   201 KRAQKAHQIRETTDMMNRLMEDMGRLIREGEHEEANGIGMGFQSIDADCRADLSQWRNLQQVVMP 265
            :|..                                    |:                       
 Frog   186 RRPD------------------------------------GY----------------------- 191

  Fly   266 QSSEIRDGQTNRTSGTEGGRSGGLTDGDDLTEIQSAAYAVYHQVLDRGYQTGRRLYDDNQGALRE 330
                  ||..||     |.|||                      ..| :..|...:.|.:....:
 Frog   192 ------DGMANR-----GDRSG----------------------FGR-FDRGNSRWSDERNDEDD 222

  Fly   331 DSIPTEDREHPENNQVDGSTYGVTRFLHWLSENFVTRHEIRAVRFGS---PHM-VFQS------- 384
            .|.|....:..|.....||..|:         ||....:|.....|:   ||: .||.       
 Frog   223 WSKPLAPNDRVEQELFSGSNTGI---------NFEKYDDIPVEATGNNCPPHIESFQDVTMGEII 278

  Fly   385 --------YDWPESPKQHISTVHQKGIFYSQPLIRTRIIATVASEPNNSSSGQLSSMV------- 434
                    |..|...::|...:          :|..|.:...|    .:.||:.::.:       
 Frog   279 MGNIQLSRYTRPTPVQKHAIPI----------IIEKRDLMACA----QTGSGKTAAFLLPILSQI 329

  Fly   435 ------NLARHQRSQNQETPDGIYVSRYNATGDEETPCSATGVPGRVVALRASSTPNEHRSDPGL 493
                  :..:|.:.      :|.|..|      ::.|.|....|.|.:|::......:       
 Frog   330 YADGPGDAMKHLKE------NGRYGRR------KQFPLSLVLAPTRELAVQIYEEARK------- 375

  Fly   494 SFIPNLTYEDGTIPSLAAGGAASTPLAPSLPAEHSLG-----LEMDSNTLVVPADADETRLVGHP 553
                 ..|.....|.:..|||             .:|     ||...:.||    |...|||   
 Frog   376 -----FAYRSRVRPCVVYGGA-------------DIGQQIRDLERGCHLLV----ATPGRLV--- 415

  Fly   554 GSTVVRSRLGGPPASTPLLSFRPRLPVIDEEHHLRFTRVSRELQMSVAFPPEETTLSEQREWGSI 618
             ..:.|.::|        |.|...| |:||...:          :.:.|.|:...:.||      
 Frog   416 -DMMERGKIG--------LDFCNYL-VLDEADRM----------LDMGFEPQIRRIVEQ------ 454

  Fly   619 FRPRDEMVNYAEGPPPRQTQRARRRSRTRRRRNRIASAASPQLTPERIVRREEAFQSSRHIAATF 683
                |.|       ||:..           |:..:.||..|              :..:.:|..|
 Frog   455 ----DTM-------PPKGV-----------RQTMMFSATFP--------------KEIQILARDF 483

  Fly   684 MSSLLQNAAGEVTTSSGLAVTRSVKEITTSVHITRNVLQEEVPPTTEATTTSLEVAQATG----- 743
            :...:..|.|.|.              :||.:||:.|:..|   ..:..:..|::..|||     
 Frog   484 LDEYIFLAVGRVG--------------STSENITQKVVWVE---EMDKRSFLLDLLNATGKDSLT 531

  Fly   744 -----------------YSDSGACMQSAAFSQDLPVVAPLEISGNASSDQASFDQALALLPPINS 791
                             |.:..||               ..|.|:.|  |...::||      :.
 Frog   532 LVFVETKKGADALEDFLYHEGYAC---------------TSIHGDRS--QRDREEAL------HQ 573

  Fly   792 TPIGQHPIAVFGPKTEIEIKPQKMDISNMMNTSVPPMPMEVDEVPLEVSNTLANMSDHAYVTDIQ 856
            ...|:.||.|     ...:..:.:||||:.:.....:|.:::|....:..|              
 Frog   574 FRSGKSPILV-----ATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRT-------------- 619

  Fly   857 ILPSLQLNSLNLVSTNITDNAVNIAPSTSTNDL---------QTPSDRRTSMQNQLYRVSMNDLA 912
                .::.:|.|.::...:..:||     |.||         :.||             .:.::|
 Frog   620 ----GRVGNLGLATSFFNEKNINI-----TKDLLDLLVEAKQEVPS-------------WLENMA 662

  Fly   913 YISQHANVVR 922
            |...|.:..|
 Frog   663 YEQHHKSSTR 672



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.