DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment solo and Ddx4

DIOPT Version :8

Sequence 1:NP_001027274.2 Gene:solo / 26067079 FlyBaseID:FBgn0283440 Length:1031 Species:Drosophila melanogaster
Sequence 2:NP_001071115.1 Gene:Ddx4 / 310090 RGDID:1308793 Length:713 Species:Rattus norvegicus

Alignment Length:271 Identity:66/272 (24%)
Similarity:90/272 (33%) Gaps:118/272 (43%)


  Fly     3 DDWDDE----------PIVD----TRGARGGDWSDDEDTAKSFSGEAEGDGVGG-----SGGEGG 48
            :||:.|          |:.:    :.||.|    |..:...:.|.|.| ||..|     ..|...
  Rat     4 EDWEAEILKPHVSSYVPVFEKDKYSSGANG----DTFNRTSASSSEME-DGPSGRDHFMRSGFSS 63

  Fly    49 GYQGGNRDV-----------FGRIGGGRGGGAGGY------------------------------ 72
            |...||||:           .|..|.|:|.|..|:                              
  Rat    64 GRNLGNRDIGESSKRETTSTTGGFGRGKGFGNRGFLNNKFEEGDSSGFWKESTNDCEDTQTRSRG 128

  Fly    73 ---RGGNRDG------GGFHGGRREGERD-FRGGEGGFRGGQGGSR------GGQGG---SRGG- 117
               |||..||      |.|..|.|:.|.| .:|.:.|  ||..|||      .|.|.   ||.| 
  Rat   129 FSKRGGYPDGNDSEASGPFRRGGRDSEYDQDQGSQRG--GGLFGSRKPAASDSGSGDTFQSRSGN 191

  Fly   118 -QGGFRG-----------------GEGGFRGRLYENEDAK-----ELPPIPSSCDKDEVGA-FID 158
             :|.::|                 .|||      |:.|.:     .:||.|.. |:|.:.| :..
  Rat   192 ARGAYKGLNEEVVTGSGKNSWKSEAEGG------ESSDIQGPKVTYIPPPPPE-DEDSIFAHYQT 249

  Fly   159 QLDLSKYTTSL 169
            .::..||.|.|
  Rat   250 GINFDKYDTIL 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
soloNP_001027274.2 None
Ddx4NP_001071115.1 Interaction with RANBP9. {ECO:0000250|UniProtKB:Q9NQI0} 213..232 5/25 (20%)
Q motif 273..301
DEADc 275..489 CDD:238167
DEXDc 288..491 CDD:214692
DEAD box. {ECO:0000250|UniProtKB:Q61496} 431..434
HELICc 499..628 CDD:238034
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.