DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment solo and glh-1

DIOPT Version :8

Sequence 1:NP_001027274.2 Gene:solo / 26067079 FlyBaseID:FBgn0283440 Length:1031 Species:Drosophila melanogaster
Sequence 2:NP_491963.1 Gene:glh-1 / 172414 WormBaseID:WBGene00001598 Length:763 Species:Caenorhabditis elegans

Alignment Length:131 Identity:52/132 (39%)
Similarity:59/132 (45%) Gaps:26/132 (20%)


  Fly    21 WSDDEDTAKSFSGEAEGDGVGGSGGEGGGYQGGNRDVFGRIGGGRGGGAGGYRGGNRDGGGFHGG 85
            |||.|..||:.:|...|.|.||....|.|:.||.....| .|||..||: |:.|||..|.||.||
 Worm     5 WSDSESAAKAKTGFGSGGGFGGGNNGGSGFGGGKNGGTG-FGGGNTGGS-GFGGGNTGGSGFGGG 67

  Fly    86 RREGERDFRGGE---GGFRGGQ------GGSRGGQGGSR--------------GGQGGFRGGEGG 127
            :..|. .|.||.   .||.||.      ||:..|.|||.              ||.|||.|...|
 Worm    68 KTGGS-GFGGGNTCGSGFGGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFGGSATG 131

  Fly   128 F 128
            |
 Worm   132 F 132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
soloNP_001027274.2 None
glh-1NP_491963.1 zf-CCHC 158..175 CDD:278525
zf-CCHC 183..200 CDD:278525
ZnF_C2HC 243..259 CDD:197667
zf-CCHC 262..279 CDD:278525
DEADc 343..558 CDD:238167
DEXDc 359..561 CDD:214692
Helicase_C 579..701 CDD:278689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.