DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and DNAH11

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001264044.1 Gene:DNAH11 HGNCID:2942 Length:4516 Species:Homo sapiens

Alignment Length:4634 Identity:2206/4635 (48%)
Similarity:3033/4635 (65%) Gaps:229/4635 (5%)


  Fly     1 MADEKEKKEPV----------DNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNK 55
            :.:|:|.:|..          |.|..|....|...:....:||::.:.:.:.|.|:.|||.:.:.
Human    35 LEEEEENEEEAAARRARSFAQDARVRFLGGRLAMMLGFTEEKWSQYLESEDNRQVLGEFLESTSP 99

  Fly    56 KRIIFTINSGGQLYPSYSFPVRPRYKVAYFIRYLT-PLHLTDENMLNSLLIGDLLPNPLANLSIL 119
            ..::|:..:.|:|..|...|....:|:.:..:.:| .:.:.|.:.:  :|.|:|....|.::|..
Human   100 ACLVFSFAASGRLAASQEIPRDANHKLVFISKKITESIGVNDFSQV--VLFGELPALSLGHVSAF 162

  Fly   120 CDEVFFPLLNNTVNQVGWTNVIANDMKTESQEMRNGIAQMKGLVINRTIFPLPI----------C 174
            .||:..|:|:|..|...|:...:.||:...:.|:..:...:|.:..||:.|:|.          |
Human   163 LDEILVPVLSNKNNHKSWSCFTSQDMEYHIEVMKKKMYIFRGKMSRRTLLPIPTVAGKMDLDQNC 227

  Fly   175 MDEVMQAAPAIAMGDISVVNPLMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSF 239
            .:....:...|.:           |::|.:|::|...:::::...:.:::.:..:.. |:|...|
Human   228 SENKPPSNERIIL-----------HAIESVVIEWSHQIQEIIERDSVQRLLNGLHLS-PQAELDF 280

  Fly   240 WESRLENLENLAEQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRK 304
            |..|.|||..:.:||....:..:..:|...||.:..:.:.|...|..:|.||:|:...|.||:|.
Human   281 WMMRRENLSCIYDQLQAPVVLKMVKILTTKQSSYFPTLKDIFLAVENALLEAQDVELYLRPLRRH 345

  Fly   305 MDKFETNDMDENRSDIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQ 369
            :...:..:..:.|..|.||..||.|:|.||::::|...:.:....|.|..|:.....:.|:.:.:
Human   346 IQCLQETEFPQTRILIAPLFHTICLIWSHSKFYNTPARVIVLLQEFCNLFINQATAYLSPEDLLR 410

  Fly   370 GDVDEAYKKLDINMQHLEYYKLIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEE 434
            |:::|:.:|:.:.:..|:.:|..:...|..|..:.:|...  :.|.:....:|.|.||||.||.:
Human   411 GEIEESLEKVQVAVNILKTFKNSFFNYRKKLASYFMGRKL--RPWDFQSHLVFCRFDKFLDRLIK 473

  Fly   435 LKDLFNTVRDFQKLEKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRD 499
            ::|:|.|..:|:|||::..||.||..:...:.::.||...:.:.:....|:|  .|..|..|:.|
Human   474 IEDIFATTLEFEKLERLEFGGTKGAILNGQVHEMSEELMELCKLFKQSTYDP--SDCTNMEFESD 536

  Fly   500 RLSFKAKTDVMERMV------SFQFEKGLEDTHDLL-LAGSLLLRPIIKK----HVEPLMHVIVD 553
            .::||:||...:|.:      :|....|||....|| :.|:.|.:|::.:    |...|:|:   
Human   537 YVAFKSKTLEFDRRLGTIICEAFFNCNGLEAAFKLLTIFGNFLEKPVVMEIFSLHYSTLVHM--- 598

  Fly   554 DFEEEI-MCVKKEFIN--FKNV---FTALGLNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHE 612
             |..|: :|  |:..|  .|.:   ...|..|       .|..||.:.:.:::..|:........
Human   599 -FNTELDVC--KQLYNEHMKQIECGHVVLNKN-------MPFTSGNMKWAQQVLQRLQMFWSNFA 653

  Fly   613 LYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDITLTLIEKDEANELR-V 676
            ...|....|.....|...:..|...:|.|...:.::|.....:..:.::...|::....|.|. |
Human   654 SLRYLFLGNPDHALVYQKYVEMTTLLDQFESRIYNEWKSNVDEICEFNLNQPLVKFSAINGLLCV 718

  Fly   677 NFTERLIFALKDIKVVRLL-GCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKR 740
            ||..:|:..|:::|.:.:| ..|:..:....|.:.:.:.:....|..:.:.||...:.....|..
Human   719 NFDPKLVAVLREVKYLLMLKKQDIPDSALAIFKKRNTILKYIGNLDLLVQGYNKLKQTLLEVEYP 783

  Fly   741 LIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKVP 805
            ||..|:..|:||:.....::.|......:|..:......|..|:...|:|::.|::::|.|.:..
Human   784 LIEDELRAIDEQLTAATTWLTWQDDCWGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCV 848

  Fly   806 LFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEED 870
            |                  |                              |||      ||    
Human   849 L------------------P------------------------------PRR------EH---- 855

  Fly   871 EESDGIWPPIISLSVMTSVKFKKKRE---VIDEEDDLEEFEEEQSESEEEIITPFHRYELLKG-- 930
                                   :||   .::::.||  |.:              :|:|::|  
Human   856 -----------------------RREAAFTLEDKGDL--FTK--------------KYKLIQGDG 881

  Fly   931 -----LSQEERALFR------EYEIYV---DEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFE 981
                 |.:|.|.||:      .::|||   |:|:.|....:::....:.....:.:.: ..|.|:
Human   882 CKIHNLVEENRKLFKANPSLDTWKIYVEFIDDIVVEGFFQAIMHDLDFFLKNTEKQLK-PAPFFQ 945

  Fly   982 IFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQ 1046
            ..|.|..|.:|:..:||..:..||...:|.:|.:...|.:.:.|:|      |::...::.:::.
Human   946 AQMILLPPEIVFKPSLDREAGDGFYDLVEEMLCNSFRMSAQMNRIA------THLEIKNYQNDMD 1004

  Fly  1047 DKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEAD 1111
            :...|.:.|.||||::...:..|..........:.||:.|::.::.....:|..::.||.||.|:
Human  1005 NMLGLAEVRQEIMNRVVNVINKVLDFRNTLETHTYLWVDDRAEFMKHFLLYGHAVSSDEMDAHAN 1069

  Fly  1112 LEGSSGVKLLGLEYPP-LSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQ 1175
            .|..        |.|| |..:|||:|.:..|..|:..:|.:..|..:.:::|..|||::|:.:.:
Human  1070 EEIP--------EQPPTLEQFKEQIDIYEALYVQMSKFEDFRVFDSWFKVDMKPFKVSLLTIIKK 1126

  Fly  1176 WISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFD 1240
            |..:|:..|:..|.:||.|||:|:.|.:..|:.||.:.|.:|||.|:..|..:..:|...|.:|:
Human  1127 WSWMFQEHLLRFVIDSLNELQEFIKETDSGLQRELNEGDHDGLVDIMVHLLAVRSRQRATDELFE 1191

  Fly  1241 PLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDN 1305
            ||||.|.||..|..:..:....|:.|||:.|...|::|||.:..::|:.:.:|.||.|:.:|.|.
Human  1192 PLKETITLLESYGQKMPEQVYIQLEELPERWETTKKIAATVRHEVSPLHNAEVTLIRKKCILFDA 1256

  Fly  1306 MANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRF 1370
            ....:|::|...........:.|..:|:::.||.||||....:.||..|||:..|:..:::.||.
Human  1257 KQAEFRERFRHYAPLGFNAENPYTALDKANEELEALEEEMLQMQESTRLFEVALPEYKQMKQCRK 1321

  Fly  1371 DLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEAS 1435
            ::||:|.:||..|.::.:|::|.||.|::|.:|.||.|.::|.:|:..|:|.:|.|:.:..:|.:
Human  1322 EIKLLKGLWDVIIYVRRSIDNWTKTQWRQIHVEQMDVELRRFAKEIWSLNKEVRVWDAYTGLEGT 1386

  Fly  1436 LKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKS 1500
            :|::..||||:||||:||:|||||.:||:...|||.::::|||.||:.|.||..|::|:.||||:
Human  1387 VKDMTASLRAITELQSPALRDRHWHQLMKAIGVKFLINEATTLADLLALRLHRVEDDVRRIVDKA 1451

  Fly  1501 VKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFE 1565
            |||:..||.:.:|:..|.||:|..::|.||.|.|||:.|:|.||||.:|.|||.:..|||:.:|.
Human  1452 VKELGTEKVITEISQTWATMKFSYEVHYRTGIPLLKSDEQLFETLEHNQVQLQTLLQSKYVEYFI 1516

  Fly  1566 HEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQM 1630
            .:|..|||:|:.||.:|.:|.||||.|.:|||||:.|||||.||.:|:||||.:|.|||.|:.:.
Human  1517 EQVLSWQNKLNIADLVIFTWMEVQRTWSHLESIFVCSEDIRIQLVKDARRFDGVDAEFKELMFKT 1581

  Fly  1631 NADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGN 1695
            ....||:.:|.|  ..|||.|:.|...|.||||||.:||||||:::||||||||||||||||.|.
Human  1582 AKVENVLEATCR--PNLYEKLKDLQSRLSLCEKALAEYLETKRIAFPRFYFVSSADLLDILSKGA 1644

  Fly  1696 NPALVARHLTKLYDSMGKL----NLISGSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITD 1756
            .|..|..||.||:||:..|    |....:..|.||.:|| :|||||...|:|.|.||.||.::..
Human  1645 QPKQVTCHLAKLFDSIADLQFEDNQDVSAHRAVGMYSKE-KEYVPFQAECECVGHVETWLLQLEQ 1708

  Fly  1757 KMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYN 1821
            .|::|:|..:..::..|:.|||.:|||::|||.||..:||.|||:...||:::::.||.||||::
Human  1709 TMQETVRHSITEAIVAYEEKPRELWIFDFPAQVALTSSQIWWTTDVGIAFSRLEEGYETALKDFH 1773

  Fly  1822 KKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWD 1886
            ||||:|||.||.||||:|...:|||||||||||||:||||..:|::||....||.|.|||||||:
Human  1774 KKQISQLNTLITLLLGELPPGDRQKIMTICTIDVHARDVVAKLISQKVVSPQAFTWLSQLRHRWE 1838

  Fly  1887 PKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETT 1951
            .....||.|||||||:|.||||||:||||||||||||||||||||||.|.|||||||||||||||
Human  1839 DTQKHCFVNICDAQFQYFYEYLGNSPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETT 1903

  Fly  1952 KDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDA 2016
            ||||||||||||||||||||||||||:|:|||.|||||||||||||||||||||||||||.|.||
Human  1904 KDLGRALGMMVYVFNCSEQMDYKSIGNIYKGLVQTGAWGCFDEFNRISVEVLSVVAVQVKMIHDA 1968

  Fly  2017 IKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVA 2081
            |:::|:.|.||||.|.|:.:||:|||||||||||.|||||||||:||||||.||..||.||:|||
Human  1969 IRNRKKRFVFLGEAITLKPSVGIFITMNPGYAGRTELPENLKALFRPCAMVAPDIELICEILLVA 2033

  Fly  2082 EGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALR 2146
            |||.:||.|||||||||||||||||||||||||||||||||||||:|:|.|:.||||||||||||
Human  2034 EGFVDARALARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDKNRPEDQVLMRALR 2098

  Fly  2147 DFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEEL 2211
            |||:|||||||:|||:||:|||||||||||:|...||.::::|.|:|:||||:.||||:||||||
Human  2099 DFNMPKIVTDDIPVFLGLVGDLFPALDVPRRRKLHFEQMVRQSTLELRLQPEESFILKVVQLEEL 2163

  Fly  2212 FAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKD-- 2274
            .|||||||::|.||||||::.:|||:||.|.|:||.:|||||||||.|||||.::.:||||||  
Human  2164 LAVRHSVFVVGNAGTGKSKILRTLNRTYVNMKQKPVWNDLNPKAVTTDELFGFIHHATREWKDGK 2228

  Fly  2275 -------GLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKE 2332
                   ||||.::|:||||...||||||||||||||||||||||||||||||||||||||||..
Human  2229 IVYSYFIGLFSSILREQANLKHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPF 2293

  Fly  2333 MRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLL 2397
            |||||||..||:|||||||||||||:|||||||.|::.||:..|.:.||.:.|.:|||||||..|
Human  2294 MRLLFEIHHLRSATPATVSRAGILYVNPQDLGWNPYVASWIDRRRHQSEKANLTILFDKYVPACL 2358

  Fly  2398 DIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQI 2462
            |..||..::||.|.:.:.:|..|.||:.:|||:|||:|.||:.||:||||..:|.||.:|.||||
Human  2359 DKLRTSFKTITSIPESSLVQTLCVLLECLLTPENVPSDSPKEVYEVYFVFACIWAFGGTLLQDQI 2423

  Fly  2463 IDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAE 2527
            .|:..:||:|:..|.||||||..||||.:|:||:|||..||.:.:.||.:|.|:|||:.||:|.|
Human  2424 SDYQADFSRWWQKEMKAVKFPSQGTIFDYYVDHKTKKLLPWADKIAQFTMDPDVPLQTVLVHTTE 2488

  Fly  2528 TTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILE 2592
            |.|||:||:.|:|...||||:|.:|.|||:.:...|::| |:.|.|:.||||:||||..||:|||
Human  2489 TARLRYFMELLLEKGKPLMLVGNAGVGKTVFVGDTLASL-SEDYIVSRVPFNYYTTSTALQKILE 2552

  Fly  2593 KPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHK 2657
            ||||||||.||||.|||::|||:|||||||||.|.||||||||||.:||.|||||||:.|::||.
Human  2553 KPLEKKAGHNYGPGGNKKLIYFIDDMNMPEVDLYGTVQPHTLIRQHIDYGHWYDRQKVMLKEIHN 2617

  Fly  2658 CNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCE 2722
            |..||||||..|||||:|||||||..||.|.||.|||..|...|.|.|...  |.|..::::...
Human  2618 CQYVACMNPMVGSFTINPRLQRHFTVFAFNFPSLDALNTIYGQIFSFHFQQ--QAFAPSILRSGP 2680

  Fly  2723 NMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRV 2787
            .::...|..|..::.:||||||||||.|||||::|:|.|:|:::.|.......:|.||:||..||
Human  2681 TLIQATIAFHQTMMCNFLPTAIKFHYIFNLRDLSNVFQGILFASPECLKGPLDLIHLWLHESARV 2745

  Fly  2788 YGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVYAQPLIYCHFAKGLTDIKYMPISGWDRLKSL 2852
            |||||:|..|.:.|::.:.:...|..||::..::..|||||||||....|..|||:..|:.||::
Human  2746 YGDKLIDKKDCDLFQRRMLETAYKYFEGIDSHMLLQQPLIYCHFADRGKDPHYMPVKDWEVLKTI 2810

  Fly  2853 LDEAQDRYNDYIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLD 2917
            |.|..|.||:...||:||||:|||.|||||||||.:.:|.|||:||||||||||:|||:::..|:
Human  2811 LTETLDNYNELNAAMHLVLFEDAMQHVCRISRILRTPQGCALLVGVGGSGKQSLSRLAAYLRGLE 2875

  Fly  2918 VFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFP 2982
            ||||.||:.|.:.:|:.::|.||::.|.|.....||:||::|..|.||||:|||||||:|.:||.
Human  2876 VFQITLTEGYGIQELRVDLANLYIRTGAKNMPTVFLLTDAQVLDESFLVLINDLLASGEIPDLFS 2940

  Fly  2983 DDEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNC 3047
            |::|:.|::.:.|||..||:||:||||||:|:.:||..||::|||||||.|||||:|||||:|||
Human  2941 DEDVDKIISGIHNEVHALGMVDSRENCWKFFMARVRLQLKIILCFSPVGRTLRVRARKFPAIVNC 3005

  Fly  3048 TTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTT 3112
            |.|||||.|||:||.|||.||:.|...:.......:|.|||.||.|||::|..|..|.:|:||||
Human  3006 TAIDWFHAWPQEALVSVSRRFIEETKGIEPVHKDSISLFMAHVHTTVNEMSTRYYQNERRHNYTT 3070

  Fly  3113 PKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEAD 3177
            ||||||.|:|:..||.:|.....:::.||.||:.||.:...:|..|:..|..||.||:::|.:|:
Human  3071 PKSFLEQISLFKNLLKKKQNEVSEKKERLVNGIQKLKTTASQVGDLKARLASQEAELQLRNHDAE 3135

  Fly  3178 NLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKN 3242
            .||..:|.:.||||:|:..|..||:.|..|:.:|..|.:.||.|.|||:|||:||..||||||:.
Human  3136 ALITKIGLQTEKVSREKTIADAEERKVTAIQTEVFQKQRECEADLLKAEPALVAATAALNTLNRV 3200

  Fly  3243 NLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHP 3307
            ||:|||:|.:||.||.:|..||:||.:.:|::||||||||.:.|||.||.||..||||||:||..
Human  3201 NLSELKAFPNPPIAVTNVTAAVMVLLAPRGRVPKDRSWKAAKVFMGKVDDFLQALINYDKEHIPE 3265

  Fly  3308 DVIKAL-QPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDA 3371
            :.:|.: :.|:.|.||:|..|..||.||||||:|||||.:||:||..||||.:||.::..|:..|
Human  3266 NCLKVVNEHYLKDPEFNPNLIRTKSFAAAGLCAWVINIIKFYEVYCDVEPKRQALAQANLELAAA 3330

  Fly  3372 RDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWME 3436
            .:||.|:..:|.:|:..|:.|...:::|.|:|.:||:|.::|..||.:||||:..|..:||||.:
Human  3331 TEKLEAIRKKLVDLDRNLSRLTASFEKATAEKVRCQEEVNQTNKTIKLANRLVKELEAKKIRWGQ 3395

  Fly  3437 SVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMI 3501
            |:|......:.|.||:|:.:.|:||||.|||.|||||....|:| |...:..||.|:|:|...|:
Human  3396 SIKSFEAQEKTLCGDVLLTAAFVSYVGPFTRQYRQELVHCKWVP-FLQQKVSIPLTEGLDLISML 3459

  Fly  3502 CDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYGTGLVVLRLSQRNY 3566
            .|||.||.|||:||||||||.||||||...||:||:||||.|||||:|.|||..|.|..|.|:.:
Human  3460 TDDATIAAWNNEGLPSDRMSTENAAILTHCERWPLVIDPQQQGIKWIKNKYGMDLKVTHLGQKGF 3524

  Fly  3567 LDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTVLKIGDREIDFNSRFRLILHTKLAN 3631
            |:.:|.|::.|.|:||||:.|.|||||:|||||..||||..::|||:|.:||..|||||||||||
Human  3525 LNAIETALAFGDVILIENLEETIDPVLDPLLGRNTIKKGKYIRIGDKECEFNKNFRLILHTKLAN 3589

  Fly  3632 PHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLL 3696
            ||||||:||||||:|||||.||||.|||||||.:||||||.::..||:.||.|||.||:||||||
Human  3590 PHYKPELQAQTTLLNFTVTEDGLEAQLLAEVVSIERPDLEKLKLVLTKHQNDFKIELKYLEDDLL 3654

  Fly  3697 ARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFIL 3761
            .|||:|..:.|:|..||..||.||.|..|||.||.|||....:|:.|||.|||.|.|||::||::
Human  3655 LRLSAAEGSFLDDTKLVERLEATKTTVAEIEHKVIEAKENERKINEARECYRPVAARASLLYFVI 3719

  Fly  3762 NDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIF 3826
            |||.||||:||||||||.|:|:.|:.:|...|.::.|:..|::|||...|:|||:.|||:|||.|
Human  3720 NDLQKINPLYQFSLKAFNVLFHRAIEQADKVEDMQGRISILMESITHAVFLYTSQALFEKDKLTF 3784

  Fly  3827 LTQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEG 3891
            |:|:..|||:...|::|.||||||||.......|...:||...|..|:|:.....|:|:::|:||
Human  3785 LSQMAFQILLRKKEIDPLELDFLLRFTVEHTHLSPVDFLTSQSWSAIKAIAVMEEFRGIDRDVEG 3849

  Fly  3892 SHKRWKKFVDSESPENEKFPGEWKGKSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSM 3956
            |.|:|:|:|:||.||.||.|.|||.||.||:|.::|.:|||||:||:|:|:|||||:||::...:
Human  3850 SAKQWRKWVESECPEKEKLPQEWKKKSLIQKLILLRAMRPDRMTYALRNFVEEKLGAKYVERTRL 3914

  Fly  3957 EFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIA 4021
            :..:.||||||.|.|||:||||||.|||:|.|||.|||:.|...||:||||||||.|||.|:|.|
Human  3915 DLVKAFEESSPATPIFFILSPGVDALKDLEILGKRLGFTIDSGKFHNVSLGQGQETVAEVALEKA 3979

  Fly  4022 SQYGHWVILQNIHLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKI 4086
            |:.||||||||:||||:||.:|||.:|......|..||:|:|||.|..|..||:|||:||::|||
Human  3980 SKGGHWVILQNVHLVAKWLGTLEKLLERFSQGSHRDYRVFMSAESAPTPDEHIIPQGLLENSIKI 4044

  Fly  4087 TNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFN 4151
            ||||||||:||:|.||.||..:|||:||||.|||:||||||||||.||.|.:||||||:||||||
Human  4045 TNEPPTGMLANLHAALYNFDQDTLEICSKEQEFKSILFSLCYFHACVAGRLRFGPQGWSRSYPFN 4109

  Fly  4152 VGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGEL 4216
            .|||||...|||||||||::|||||||||||||||||||||||||:|||.||||||.|.|.:.||
Human  4110 PGDLTICASVLYNYLEANSKVPWEDLRYLFGEIMYGGHITDDWDRKLCRVYLEEFMNPSLTEDEL 4174

  Fly  4217 EYCQGFPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPR--MT 4279
            ....||.||..|.|.|||.||::.||.|||:|||||.||||.|||..|..|||.:.|:|||  ::
Human  4175 MLAPGFAAPPYLDYAGYHQYIEEMLPPESPALYGLHPNAEIEFLTVTSNTLFRTLLEMQPRNALS 4239

  Fly  4280 GGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVEDRSPYIIVAFQECERMNNLMTELKR 4344
            |...|..|   |:.:||:::|||:|.|..||:.|:|.:..:||||::|.||||||||.|:.|::.
Human  4240 GDELGQST---EEKVKNVLDDILEKLPEEFNMAEIMQKNSNRSPYVLVCFQECERMNILIREIRI 4301

  Fly  4345 SLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVA 4409
            ||.:|||.|||||.:|..:|.....|..|.||:.|:||||||..||..||:||:||.|||:.|..
Human  4302 SLEQLDLSLKGELALSPAVEAQQFALSYDTVPDTWSKLAYPSTYGLAQWFNDLLLRCRELDTWTQ 4366

  Fly  4410 DFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGL 4474
            |..:|:.:||:|||||||.||||||..|||||||||:..|..|||||.||:....||||||::||
Human  4367 DLTLPAVVWLSGFFNPQSFLTAIMQTMARKNEWPLDKTRLTADVTKKTKEDYGHPPREGAYLHGL 4431

  Fly  4475 FMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGPTFVWTFNL 4539
            ||||||||.:.|||.:|.||||...|||::.||...|:|:.|..||||||:.:||||:::|||.|
Human  4432 FMEGARWDTQAGTIVEARLKELACPMPVIFAKATPVDRQETKQTYECPVYRTKLRGPSYIWTFRL 4496

  Fly  4540 KSRERASKWTLAGVCLLLQ 4558
            ||.|:.:||.||||.|||:
Human  4497 KSEEKTAKWVLAGVALLLE 4515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 137/585 (23%)
DHC_N2 1368..1770 CDD:285579 196/406 (48%)
P-loop_NTPase 1903..2132 CDD:304359 195/229 (85%)
P-loop_NTPase 2217..2352 CDD:304359 104/144 (72%)
P-loop_NTPase 2510..2783 CDD:304359 154/273 (56%)
P-loop_NTPase 2860..3127 CDD:304359 155/267 (58%)
MT 3140..3480 CDD:289543 163/341 (48%)
AAA_9 3509..3722 CDD:289547 140/213 (66%)
Dynein_heavy 3864..4549 CDD:281078 416/687 (61%)
DNAH11NP_001264044.1 Stem. {ECO:0000250} 1..1854 602/1965 (31%)
DHC_N1 239..812 CDD:285571 137/602 (23%)
DHC_N2 1319..1722 CDD:285579 196/406 (48%)
P-loop_NTPase 1855..2084 CDD:304359 195/229 (85%)
AAA 1. {ECO:0000250} 1855..2076 190/221 (86%)
AAA 2. {ECO:0000250} 2136..2366 156/230 (68%)
P-loop_NTPase 2169..2313 CDD:304359 104/144 (72%)
P-loop_NTPase 2471..2741 CDD:304359 154/273 (56%)
AAA 3. {ECO:0000250} 2472..2719 146/250 (58%)
AAA 4. {ECO:0000250} 2817..3066 142/249 (57%)
P-loop_NTPase 2818..3085 CDD:304359 155/267 (58%)
Stalk. {ECO:0000250} 3072..3403 155/331 (47%)
MT 3097..3441 CDD:289543 165/345 (48%)
AAA 5. {ECO:0000250} 3459..3686 149/227 (66%)
AAA_9 3468..3680 CDD:289547 140/212 (66%)
Dynein_heavy 3820..4506 CDD:281078 416/689 (60%)
AAA 6. {ECO:0000250} 3896..4122 148/226 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1463at33208
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.