DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and VANGL1

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001165883.1 Gene:VANGL1 HGNCID:15512 Length:524 Species:Homo sapiens

Alignment Length:570 Identity:106/571 (19%)
Similarity:198/571 (35%) Gaps:179/571 (31%)


  Fly   858 RYSLPPGEHGEEDEESDGIWP----PIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEI 918
            |:..|..:.|...|:|..|.|    |::.                   :|....||.|.::..|.
Human    30 RHKSPRNKDGRGSEKSVTIQPPTGEPLLG-------------------NDSTRTEEVQDDNWGET 75

  Fly   919 ITPFHRYELLKGLSQEERALFREYEIYVDEI--IAENLVDSV---------ITSSTYLRMEVDNR 972
            .|      .:.|.|        |:.|..::|  |::::.|||         :|.:::|.:.|   
Human    76 TT------AITGTS--------EHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFLGLLV--- 123

  Fly   973 YENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMN 1037
              ..|||..|.:    |.:::...|:.........||....    .::.||            :.
Human   124 --FLTPIAFILL----PPILWRDELEPCGTICEGLFISMAF----KLLILL------------IG 166

  Fly  1038 PYSFYDELQDKSELDKQRVEIMNKIKLAL-----------QAVRV------HGKGFMEF------ 1079
            .::.:..   |...|..||.:...:.|.|           ..||:      :.:|.:::      
Human   167 TWALFFR---KRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDRNYQGIVQYAVSLVD 228

  Fly  1080 SSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQ 1144
            :.|:|...:..|.|:::.....||   ......:|.|....||    .||:.:..|   :.|::.
Human   229 ALLFIHYLAIVLLELRQLQPMFTL---QVVRSTDGESRFYSLG----HLSIQRAAL---VVLENY 283

  Fly  1145 IRTWETYEDFFVF-----------LRLNMTGFKVAVL-----SQVGQWISLF------------- 1180
                  |:||.::           ...:|.|.||..:     :..||..::.             
Human   284 ------YKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAAAARRRDSSHNE 342

  Fly  1181 ----KLDLINRVKNSLKELQDFVDEANIVLK----IELQKDDFEGLVKILSVLNQINEKQCIYDS 1237
                :.:...|||.....|...|:||.|.::    .|.||...|       |::.....|.|:.|
Human   343 LYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGE-------VMDPREAAQAIFPS 400

  Fly  1238 MFDPLKEIIDLLRQYNYEFKDTELAQI------NELPDAWMKVKRLAATTKQLIAPIQSYQVD-- 1294
            |...|::.:.:.||.||...::.|..:      ...|.|::: :.|:|      .|...|..|  
Human   401 MARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLE-RYLSA------GPTLQYDKDRW 458

  Fly  1295 -LIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEE 1343
             ..:.|::..:.:.|..|...:    |.:.||....:::...:..:.|.|
Human   459 LSTQWRLVSDEAVTNGLRDGIV----FVLKCLDFSLVVNVKKIPFIILSE 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571
DHC_N2 1368..1770 CDD:285579
P-loop_NTPase 1903..2132 CDD:304359
P-loop_NTPase 2217..2352 CDD:304359
P-loop_NTPase 2510..2783 CDD:304359
P-loop_NTPase 2860..3127 CDD:304359
MT 3140..3480 CDD:289543
AAA_9 3509..3722 CDD:289547
Dynein_heavy 3864..4549 CDD:281078
VANGL1NP_001165883.1 Strabismus 25..524 CDD:310915 106/571 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.