DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah12

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_021325607.1 Gene:dnah12 ZFINID:ZDB-GENE-090311-9 Length:3969 Species:Danio rerio

Alignment Length:4193 Identity:1332/4194 (32%)
Similarity:2079/4194 (50%) Gaps:580/4194 (14%)


  Fly   577 GLNELPTDDCFPKVSGAISFLK-KLRHRIIGLHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDD 640
            |.|||..|.| .:||.  |:|| .:::|:..:.|..:..:....|.:...           ||.|
Zfish   143 GRNELLEDIC-KEVSE--SYLKVMIKYRVSTILKNPQSADTASQDWKGSA-----------EILD 193

  Fly   641 FTKMLLDKWTVECWQGIQQDITLTLIEKDEANELRV---NFTERLIFALKDIKVVRLLGCDVSVN 702
            |:....|.: |:..:.||::  |.::.....:.|.:   .|:..|:..|.|.:....:.|:...|
Zfish   194 FSCPWHDSF-VQSRREIQKN--LHILHPAMKSVLDICYSTFSHLLLIDLSDCRSTGPVDCESLKN 255

  Fly   703 LTKFFCR--EDELWQARVKLMRIAEWY---------NDTFERAHPTEKRLIA---AEMILIEEQM 753
            .....|.  |:.|.:|         |:         .||.::..|  |:|.:   ....||..|:
Zfish   256 KVAVECERVEERLMKA---------WFPKIIHLLTSKDTLQKVKP--KKLDSFYNCASTLISNQL 309

  Fly   754 KPLLD-----FI---------KWNAFSQRFIVMIFKMVKY--LHDRLVAAQENLEAIK------E 796
            |.|::     |:         |...|....|....||..|  .||..:|..|....|.      :
Zfish   310 KALVEKSVTAFVSLFDPLNINKLPLFKMDLIFDDEKMDFYPNFHDLELAVLEIANLISNTMQKVQ 374

  Fly   797 SIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAAD-----TQRLIDLLMYVNL----KLF 852
            :|:||                    ..|..:|:..|..:|     .|..:...:.:||    |.|
Zfish   375 TIQSW--------------------LAEGSISVIDAKLSDHVQVWAQTTLRNAVRMNLEGPAKHF 419

  Fly   853 FDIPRRY-------------SLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDL 904
            .....||             .|...||..::......|             |:...:.|.....|
Zfish   420 QSYVDRYDWLVNGTAQAQVDKLMEEEHSFDEHTKQVEW-------------FRALSKEISSLPSL 471

  Fly   905 EEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEV 969
            ..|:..:.:.|          ||.:||:::..||        .:||...||.|....|..:..|.
Zfish   472 IHFDMVRLDCE----------ELKQGLAKKANAL--------SKIIVGKLVSSHHQCSLQICEEF 518

  Fly   970 DNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNN-MMSLLKRVAQDPTEV 1033
            :...:....:.|...|:.| .:.|...:.|..           ::::|| :|...:|:       
Zfish   519 EAIRDRALKVPETTEEMME-MITYINQVKTKG-----------IEELNNRIMEAQQRM------- 564

  Fly  1034 TNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLW------IWDKSTYLS 1092
                     :.|.|        |.|.|:..|.|....:          ||      |:|:|    
Zfish   565 ---------NYLMD--------VHIFNEEHLDLNTTVL----------LWPQNINPIFDQS---- 598

  Fly  1093 EVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVF 1157
                       ||...||.|:|.:          .||..:|:|                     .
Zfish   599 -----------DEVMDEAKLKGQN----------DLSGRREKL---------------------L 621

  Fly  1158 LRLNMTGFKVAVLSQVGQWISLFKLDLINR----VKNSLKELQDFVDEANIVLKIELQKDDFEGL 1218
            |.|:..|.::...::..:      ||:|.:    |:..||.|||.  |.:|         ||   
Zfish   622 LELDKVGRRMEEFAECSE------LDMIQQYAADVRTVLKRLQDI--EESI---------DF--- 666

  Fly  1219 VKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQ 1283
                     ||:::.:                   |:::.|...::..:.::             
Zfish   667 ---------INKEEAL-------------------YQWEKTSYPEVEVIKES------------- 690

  Fly  1284 LIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRSL 1348
                |:.||     |...|......| |||::...|.        :|..|| :|| .:||..|.:
Zfish   691 ----IEPYQ-----KLFTLVLKWQRT-RKKWMDGSFL--------DLNGES-IEL-EVEEYVREM 735

  Fly  1349 AESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQE----- 1408
            .:....|:.:   ..|.||.:                :.|....|||   |.|.|:..:|     
Zfish   736 YKMLKFFQQK---QKKAELKK----------------EKTAGLKKKT---KEDQEDDKKESATIL 778

  Fly  1409 -CKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSM 1472
             |....:::    |..:.:.|.                |:.|.||.||.|||.::.:......:.
Zfish   779 ICSSVVKQV----KEFKEYIPL----------------VSILCNPGIRPRHWEQMSEIAGQDLTP 823

  Fly  1473 DDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKA 1537
            |..:||:.::..||..|.|..:.|...:.||..:|:.::.:..||.|:.|....:..|.:.:|.:
Zfish   824 DSGSTLRKILKQNLTPYLELFEGISAGASKEFGLERAMQTMVEAWDTVSFHYHPYRDTGVSILSS 888

  Fly  1538 SEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGS 1602
            .:|:...|:|...:.|.|..|.:|..||.|:::|:.||......|..|.:||.:|.|||.|| .|
Zfish   889 VDEIQTMLDDQIVKTQTMRGSPFIKPFETEIKVWEERLIGIQDTIDEWLKVQHQWLYLEPIF-SS 952

  Fly  1603 EDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALND 1667
            |||..|:||:.|.|..::|.::.::|....|..::.:|:..|  |:|.|:....:|....|.||.
Zfish   953 EDIMKQMPEEGRLFQIVNKHWREVMANCVKDPKILAATSLPG--LFEKLQESYNLLENIMKGLNA 1015

  Fly  1668 YLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLISGSKNAAGMVAKELE 1732
            |||.|||.:|||:|:|:.::|:|||...:|..|..||.|.::.:.||:.:. :.:...|.:.|.|
Zfish  1016 YLEKKRLFFPRFFFLSNDEMLEILSETKDPTRVQPHLKKCFEGIAKLDFLP-NLDIQAMYSSEGE 1079

  Fly  1733 --EYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQ 1795
              |::..:...:..|.||.||.::.|.|..::||.:.||...|....|..|:.|||.|..|..:|
Zfish  1080 RVEFIQLISTSEARGAVEKWLVQVEDIMLRSIRDVINRSRLAYPETKRSQWVREWPGQVVLCASQ 1144

  Fly  1796 IMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDV 1860
            :.||.|.::|.    :...|.||.|.::...|||:::.|:.|.|....|..:..:.|||||:|||
Zfish  1145 MYWTVEVHEAI----RSSANGLKKYYEQLQNQLNDIVELVRGKLPKQTRTTLGALVTIDVHARDV 1205

  Fly  1861 VGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYI 1925
            :..:|.|.|..:|.|||.:|||:.|  ..|:....|.:...:|.||||||:|||||||||||||.
Zfish  1206 ILELIEKGVSSETDFQWLAQLRYYW--ANDNVRVRIINCDVKYAYEYLGNSPRLVITPLTDRCYR 1268

  Fly  1926 TLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWG 1990
            ||..:.:|.:||||.||||||||||||||.:||.:...|||||:.:||.::|...||||.:|||.
Zfish  1269 TLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWA 1333

  Fly  1991 CFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPE 2055
            ||||||||.:|||||||.|:.|||.||:.:.:.|.|.|..:.|.....|.||||||||||:|||:
Zfish  1334 CFDEFNRIELEVLSVVAQQILCIQRAIEMRLEYFDFEGTELRLNPNCFVAITMNPGYAGRSELPD 1398

  Fly  2056 NLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKS 2120
            |||.|:|..||:||::|||:||.|.:.||..|:.|:.|.:..|.||.|.||.|.|||:|:||:|:
Zfish  1399 NLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKA 1463

  Fly  2121 VLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAV 2185
            |||.||.|:.......||.:|:|:::|.|.||.::.|:|:|.|:..||||.:.:|......|...
Zfish  1464 VLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPVADYKLFLEC 1528

  Fly  2186 IKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTL-------NKTYQNQK 2243
            ......:..:||...|:.||:|..|:..|||...::|....||::|...|       |::..|::
Zfish  1529 AHLCCENHNVQPVKVFLDKIIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNESGYNEE 1593

  Fly  2244 RKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIES 2308
            .|..|..:|||::|..:|||..:|.:.||.||:.:...|:.|:......||:|.||.||.:||||
Zfish  1594 EKVIYQTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFASSETPERKWVVFDGPIDTLWIES 1658

  Fly  2309 LNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWL 2373
            :|||:||||.|.|.|.|.|.::.:|.|:||...|..|:||||||.|::|:.|..|||||.:.||:
Zfish  1659 MNTVLDDNKKLCLMSGEIIQMSSQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWTPLVLSWM 1723

  Fly  2374 GT-------RTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLT-PQ 2430
            .|       :.||   ::|..||:..:||.|.:.|.:.|.:.|.|:...:.....|.:.:|| |.
Zfish  1724 KTLPDPLQAQDNS---TLLQQLFEWLLPPTLVLLRKQCREVIPSSNSNTVVSLTRLFEMLLTRPV 1785

  Fly  2431 NVP--NDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEY---KAVKFPL------ 2484
            |..  |...:.|....|.|.:||..|.....|.    .:.|.| ||.|.   ||...|:      
Zfish  1786 NEDPGNKNMRTWIMAAFAFALVWSVGGCCDTDS----RSRFDK-FLREMISGKAENCPIPAAVSK 1845

  Fly  2485 -------SGTIFSFYIDHETK-KFFPWTNLVPQFEL-DMDLPLQSNLVNTAETTRLRFFMDTLIE 2540
                   .|.::.:..:.:.| ::..|...:....| |.:..:|..:|.|.:|.|..:.||..|:
Zfish  1846 WECPFDEKGLVYDYSYEFKGKGRWVHWNESISNAPLGDKNTKVQDIIVPTIDTVRYTYLMDLCIQ 1910

  Fly  2541 ADHPLMLIGPSGSGKTILMNAKL-SALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYG 2604
            ...||:|:||:|:||::.:..|| :.|..|.:....:.|:..|::...|.|:...|:|:....||
Zfish  1911 YGRPLLLVGPTGTGKSVYVKEKLMNNLDKDLFLPFFINFSARTSANQTQNIIMSRLDKRRKGVYG 1975

  Fly  2605 PIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWY---DRQKMTLRDIHKCNIVACMN- 2665
            |...|:.|.||||||||..:.:....|..|:||:.|:.:||   |..|:||.|:   .:::.|. 
Zfish  1976 PPMGKKCIIFVDDMNMPAKEVFGAQPPVELLRQYFDHGNWYDLKDTSKITLTDM---QLISAMGP 2037

  Fly  2666 PSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAIT 2730
            |..|...:.||..|||...::|..|.:::..|.::|::.::..  .:|......:...:|:..:.
Zfish  2038 PGGGRNAVTPRFLRHFNICSINAFSDESMVRIFSNIVTFYLRT--NEFPPDCFTVGNQIVSATLE 2100

  Fly  2731 LHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDY 2795
            ::.|.:.:.|||..|.||.|||||.:.:..|.|....|:..|...||||::||.|||:.|:|||.
Zfish  2101 VYQKAIENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLTNKRTMIRLFVHEIYRVFYDRLVDD 2165

  Fly  2796 TDINSFKKIVSDIVRKGIEGVNDDVVYAQPLIYCHFAKG------------------LTDIK--- 2839
            .|......:.|:||::..:. |.|.|:.      |...|                  :.|:.   
Zfish  2166 QDRAWLFTLTSNIVKQHFKD-NFDSVFE------HLKDGNKPLCEENMRNLLFGDYMMPDVDESE 2223

  Fly  2840 --YMPISGWDRLKSLLDEAQDRYND-YIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGS 2901
              |..:...:|...:::...|.||. :...||||:|...:.|:.||||:|:...|.|||:|||||
Zfish  2224 RLYAEVPSVERFGEVVETCLDEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGS 2288

  Fly  2902 GKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLV 2966
            |:||:||||:|:|::.:||.:::|.|.:::.:.::..|...||||.....||:||:::..|.||.
Zfish  2289 GRQSITRLATFMSNMTLFQPEISKSYGMNEWREDLKRLMKNAGVKGEKTVFLLTDAQIKDEAFLE 2353

  Fly  2967 LVNDLLASGDIHELFPDDEVENIVNAVRN---------EVKQLGIVDNRENCWKYFIEKVRSLLK 3022
            .|:.:|.:|::..:|..||.:.|:.|||.         |...|.:       :.||:.:.:..|.
Zfish  2354 DVDSILNTGEVPNIFAVDEKQEIMEAVRPFAQAGNKNLEFSPLAL-------FAYFVTRCKENLH 2411

  Fly  3023 VVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLS--EITVLPKELALPVSN 3085
            :|:.|||:|...|.|.|:||:|:||.|||||..||::|||.|:.:||.  :::.|.::..:|:..
Zfish  2412 IVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEEALERVANKFLETLDLSDLERKEVVPICK 2476

  Fly  3086 FMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLAS 3150
            ..   |.:..|:|..:|....|:||.||.|:|||||.:..||.::....:..:.|..|||.|||.
Zfish  2477 TF---HTSAIDLSNRFLIELGRHNYVTPTSYLELIAAFRLLLTQRRDTVMSAKNRYTNGLDKLAF 2538

  Fly  3151 CTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKA 3215
            ...:|..::.  ::.:::.|::..:.||..|:...|.|.|..|     .:.|.||..||..|.||
Zfish  2539 AESQVSEMKK--ELVDLQPKLEQAKIDNTKIMEVIEVESVEVE-----AKSKLVRVDEEAATLKA 2596

  Fly  3216 -------KLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGK 3273
                   ..||.|..:|.|||.||..||:||...::|.:|:..:||..|..|..||.|:...|.:
Zfish  2597 NEAQALKNECESDLAEAIPALEAALSALDTLKPADVTIVKAMKNPPAGVKLVMAAVCVMKDIKPE 2661

  Fly  3274 IPKDRS---------WKACRAFMGNVDKFLDNLINYDKKHIHPDVI-KALQPYILDAEFSPEKIL 3328
            ...|.|         |...:..:|::: ||.:|..|||.:|...|: |....|:.:.:|.|.|::
Zfish  2662 RINDPSGTGQKILDYWGPSKKLLGDMN-FLRDLKEYDKDNIPAQVMHKIRSEYMTNPDFDPTKVV 2725

  Fly  3329 AKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQ 3393
            ..||||.|||.|:..:..:..|..||.||:..|:.:::.:......|......|.|:|::|.|||
Zfish  2726 KASSAAEGLCRWITAMEVYDRVAKVVAPKKANLIVAQESLATTMALLNQKRAELKEVEDRLAALQ 2790

  Fly  3394 MEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCF 3458
            ...:|...:|.:.:.:....|..::.|.:|||||..||.||:::...|......|.||:||.:..
Zfish  2791 KTLEEKTEEKAQLEFQVDLCARKLERAEKLIGGLGGEKNRWLKAANDLQCTYDNLTGDVLISAGV 2855

  Fly  3459 ISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAE 3523
            |:|:|.||..:|.:. .|:|....|:.:  |||:|.....:.:.|..:|..||..|||:|..|.:
Zfish  2856 IAYLGAFTARFRHDC-TKMWAQLCKSKK--IPSSDDFSLSKTLGDPIKIRAWNIAGLPTDSFSID 2917

  Fly  3524 NAAILVQSERYPLMIDPQLQGIKWVK-TKYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGE 3587
            |..|:..|.|:|||||||.|..|||| ::....|.|::|:..:|:..:|..:..|:.||:||:||
Zfish  2918 NGVIVSNSRRWPLMIDPQGQANKWVKNSERDHNLNVIKLTDADYMRTLENCIQFGTPLLLENVGE 2982

  Fly  3588 NIDPVLNPLLGRQLIKKGTV--LKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVT 3650
            .:||.|.|||.:|:.|:|.|  :::|:..|::::.||..:.|||.||||.||:..:..|:||.:|
Zfish  2983 ELDPSLEPLLLKQVFKQGGVDCIRLGESVIEYSADFRFYITTKLRNPHYLPELATKVCLLNFMIT 3047

  Fly  3651 RDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMN 3715
            .:|||||||..||..|||:||..|..|..|....|..||.:||.:|..|.|:..|:|||.:.:..
Zfish  3048 PEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDQILETLQSSEGNILEDESAIQI 3112

  Fly  3716 LEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTV 3780
            |:..|..::||..|...|:.|.::|..:||.||..|:.:||::|.:.||..|:|:||:||..|..
Zfish  3113 LDAAKLMSNEITKKQQIAEKTEIEIAESREGYRAIAKHSSILFFTIADLANIDPMYQYSLNWFVN 3177

  Fly  3781 VFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTE 3845
            ::.|::|.:..::.|:.|:..|||..|:..:....|.|||:|||:|...||..:|:...|:|.:|
Zfish  3178 LYVNSILDSNKSKNLEKRLRYLIDYFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYSE 3242

  Fly  3846 LDFLLRFPY-----MPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESP 3905
            ..|||....     :||...|  ||....|..|...::.....|:::....|.:.:....||:.|
Zfish  3243 FMFLLTGGVGLQNSIPNPDPN--WLPDKSWDEICRASDLPALNGIKESFIKSPESFLPIYDSKEP 3305

  Fly  3906 ENEKFPGEWKGK-SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPET 3969
            .|...|..|..| :.:|::.|.||:|||::..|:..|:.:|||..:::....:.|:::.:|:...
Zfish  3306 FNTALPKPWCDKLNELQKMIIYRCLRPDKIEPAISKFVTDKLGKIFVEPPPFDLSKSYNDSNCTI 3370

  Fly  3970 HIFFVLSPGVDPLKDVEKLG--KSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQN 4032
            .:.||||||.||:..:.|..  |::|.|    .|.|:||||||..:|...|..|.:.|.||.|||
Zfish  3371 PLVFVLSPGADPMASLLKFANDKNMGGS----QFKSISLGQGQGPIAVKLIRSAMKDGTWVCLQN 3431

  Fly  4033 IHLVARWLPSLEKKMES-SLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMA 4096
            .||...|:.:|||..|. |....|.::||:|::.|:  |.   .|..||::.:|:|||||||:..
Zfish  3432 CHLAVSWMSTLEKICEDLSPDTCHPNFRLWLTSYPS--PR---FPVTILQNGVKMTNEPPTGLRL 3491

  Fly  4097 NIHKAL--DNFSD-ETLEMC-SKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTI 4157
            |:.::.  |..|| :....| .||..::.:|:.:|:|||:|.||:||||.|||..|.||..||.|
Zfish  3492 NLLQSYLSDPISDADFFAGCPKKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRI 3556

  Fly  4158 SVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQGF 4222
            |:..|..::.....||:|.:.||.||..|||.:||||||||..|.|.:|...::|| ...|  .|
Zfish  3557 SIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVID-HPRY--SF 3618

  Fly  4223 PAPGILKYTG-----YHNYID--DNLP-SESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMT 4279
            ...|  ||..     |.:|::  ..|| ::.|.::|:|.|.:|......::.||..:...|   .
Zfish  3619 SPSG--KYHAPPKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQ---G 3678

  Fly  4280 GGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGR----VEDRSPYIIVAFQECERMNNLMT 4340
            |||.||.....:..:.:|..|||.|.|..|:|...:.:    .|:....::|  ||.:|.|||.:
Zfish  3679 GGSKGGGGSGGDSTLLDIANDILSKLPGNFDIESALVKFPVCYEESMNTVLV--QEMQRYNNLSS 3741

  Fly  4341 ELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELE 4405
            .::.||..|...:||.:.:.:.:|.:...|.:.:|||:|.|.:|||:..|.|:.:|.:.||:.|:
Zfish  3742 TIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQ 3806

  Fly  4406 GWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGAY 4470
            .|. |.:.|...||:|||..|:.:|..:|..|||...|:|.:..|.:|..  .:...::|.:|.|
Zfish  3807 DWY-DTQKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVLP--FDTSDSSPEDGVY 3868

  Fly  4471 INGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQD-IKNVYECPVYKIRLRGPT-- 4532
            |:|||::|||||.|.|.:|:.:.|.||.|:|:::||...:...| ..:||.||:||...|..|  
Zfish  3869 IHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKPTDKKAMDQPHSVYVCPLYKTSERKGTLS 3933

  Fly  4533 -------FVWTFNLKSRERASKWTLAGVCLLLQ 4558
                   ||.|..|.:.:|...|...||.||.|
Zfish  3934 TTGHSTNFVITMMLPTSKRPQHWIKRGVALLCQ 3966

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 47/218 (22%)
DHC_N2 1368..1770 CDD:285579 118/410 (29%)
P-loop_NTPase 1903..2132 CDD:304359 137/229 (60%)
P-loop_NTPase 2217..2352 CDD:304359 57/142 (40%)
P-loop_NTPase 2510..2783 CDD:304359 88/279 (32%)
P-loop_NTPase 2860..3127 CDD:304359 106/279 (38%)
MT 3140..3480 CDD:289543 113/357 (32%)
AAA_9 3509..3722 CDD:289547 93/216 (43%)
Dynein_heavy 3864..4549 CDD:281078 248/715 (35%)
dnah12XP_021325607.1 SMC_N 516..>773 CDD:330553 81/452 (18%)
DHC_N2 691..1118 CDD:312039 139/489 (28%)
MT <951..3603 CDD:330758 984/2713 (36%)
AAA_9 2904..3120 CDD:315453 93/216 (43%)
Dynein_heavy 3263..3964 CDD:308587 252/725 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.