DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah17

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_006534213.1 Gene:Dnah17 MGIID:1917176 Length:4459 Species:Mus musculus

Alignment Length:4583 Identity:2367/4584 (52%)
Similarity:3156/4584 (69%) Gaps:163/4584 (4%)


  Fly    12 DNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGGQLYPSYSFPV 76
            |.|.::.....:..::.|.|||.|:|...|...::.||.:..:...::.|:|:.|.:.|...||.
Mouse     3 DLRIDYLETVSSVLLKFKADKWGKLIGAEENMALLTEFFDKIDNPVLVLTLNAAGMIIPCLGFPE 67

  Fly    77 RPRYKVAYFIRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFPLLNNTVNQVGWTNVI 141
            ..:.|..|||: :.|.::|.:|....|:.||:.|..:..|..:.:||.:.|||.:.|..||..|:
Mouse    68 SLKSKGVYFIK-MKPENITKDNYKTHLIYGDISPTTVDQLIAVVEEVLYSLLNQSENMDGWPRVV 131

  Fly   142 ANDMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEV------MQAAPAIAMGDISVVNPLMKHS 200
            :.|:..:...::|.:..|.|.:..:|:.|:|..:..:      |:..|:      |:.|.|: ||
Mouse   132 SEDIVKQVHRLKNEMFVMGGKIKGKTLLPIPEHLGSLDGTLDSMERIPS------SMDNSLL-HS 189

  Fly   201 LEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIKTIGFV 265
            :|.:::.|...:.|:::..:.:.:....: |||...|.||::||.||:.:.|||...::..|..:
Mouse   190 IETIIIDWSHQIRDVLSKDSAQALLDGLH-PLPRVEFEFWDARLMNLQCIHEQLNRPKVNKIVEI 253

  Fly   266 LEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLMLTIGLV 330
            |||.:|.:..:.:.:...|.:.|.||..|...|.||:..:::.|..|.....|.|..::.||..:
Mouse   254 LEKAKSCYWPALQNVYMNVTQGLKEANGIVLYLKPLRILLEEMEQADFTMLPSFIVKVLSTICFI 318

  Fly   331 WGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSI---FQGDVDEAYKKLDINMQHLEYYKLI 392
            |..|.:::|.:.:.:....|.|.:|:.....:.||.:   .||:::|....:.:::..|:.....
Mouse   319 WATSEHYNTPSRVIVILREFCNQIIEMTRTYLSPDEVLKGLQGEIEEVLGNISLSVSVLKGLFQA 383

  Fly   393 YNECRNSLKKFKIGTTFNSQ---DWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKLEKIVMG 454
            |:.|..::|.|     |..:   .|.:.....|.|::.|..|::.::||:.|..:|.|||||.:|
Mouse   384 YDFCCANMKLF-----FKDRPPVPWEFPSSLAFSRMNSFFHRVQTIEDLYKTAIEFLKLEKIELG 443

  Fly   455 GLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTDVMERMVSFQFE 519
            |:.|..:...:.:|.:|...:.:.:...:|:|:||.  :|.|..|...|:.|...::|.::..|.
Mouse   444 GVWGNILGNLVTQIYDEVFELVKVFAECKYDPLDPG--DSSFDDDYSDFETKIQDLDRRLATIFC 506

  Fly   520 KGLEDTHD-------LLLAGSLLLRPIIKKHVEPLMHVIVDDFEEEIMCVKKEFINFKNVFTALG 577
            :..:|.:.       |.:.|.||.||:|...|.|...|:::.|..|:...|   :.:.....|..
Mouse   507 QAFDDCNCMESSAKLLYMCGGLLERPLILVEVVPRYSVMLEMFNTELDNAK---LMYDAQMAASA 568

  Fly   578 LNELPT--DDCFPKVSGAISFLKKLRHRIIGLHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDD 640
            ..::|.  .:..| |||.:.:..:|:.|:....|..:..|:|:..:.....:.|.::.|:..:..
Mouse   569 DGQIPPIHKNMSP-VSGQLKWSLELQERLEVSMKYLKHIEHPVMSSMEAKLIYDKYDEMMGLLQS 632

  Fly   641 FTKMLLDKWTVECWQGIQQD----ITLTLIEKDEANEL-RVNFTERLIFALKDIKVVRL-LGCDV 699
            .......:|.    :|:.||    :...||::|....| :|||::.|:..|:::|.:.. ...::
Mouse   633 CRMKKYQQWV----EGVDQDCHFNLGQPLIQRDPFTSLIQVNFSKALVAVLREVKYLNFQQQKEI 693

  Fly   700 SVNLTKFFCREDELWQARV-KLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWN 763
            ..:..|.| .|:|.::..| .|..|..|||:........|..||.:|:..|:.::......:.||
Mouse   694 PESAEKLF-SENETFRKFVGNLELIVGWYNEIKTTVKDVEFPLIKSELEAIDVKLLSAETTLFWN 757

  Fly   764 AFS-QRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPIL 827
            ..: ..:|..:.:|:..|.:|:..|::|:|.|.::::.|...|||:|||.....||..|.|...|
Mouse   758 GENVMEYIQEMREMLYNLQNRIQKAKQNVEGITQAMQEWSANPLFERKDNKKEALLDLDGRVANL 822

  Fly   828 SIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFK 892
            :.|.|...:....|..::..|.:||               ..|..|.. |               
Mouse   823 NKRYAAVKEAGVRIQAMVVENAELF---------------RADTTSQS-W--------------- 856

  Fly   893 KKREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDS 957
                                                           ::|..|:|.::.:.....
Mouse   857 -----------------------------------------------KDYVNYIDTVVLDEFDRF 874

  Fly   958 VITSSTYL--RMEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMM 1020
            :..|..||  .|.:|   |:..|:|||.|||.:..:.|..:|:...:.||...||.:::|:.|:.
Mouse   875 IRKSLNYLMDNMTMD---ESIAPLFEIRMELDKDGLTYNPSLEMGDEAGFLSLIEGLINDLYNVA 936

  Fly  1021 SLLKRVAQDPTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIW 1085
            .|:.|:|:        ...::..:|:|.::|.:.|.|:.:.:..|::....:...|..:|.||:.
Mouse   937 RLIPRLAK--------GRLNYKSDLEDITDLIEMREEVSSLVIGAMKVAEEYQDSFERYSYLWVD 993

  Fly  1086 DKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWET 1150
            |...::.....||...|.:|.|.:.|       ..:....|.|:.:::|:|.:.:|.:::.:.|.
Mouse   994 DLQEFMKNFLIFGHAPTPEELDTKTD-------DTIPKTPPTLAQFQQQIDSYEKLYEEVSSCEN 1051

  Fly  1151 YEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDF 1215
            .:.|..:|:.:...||..:|:.:.:|..|||..|.|.|.|||.:|:.|::.....||..|::.|:
Mouse  1052 TKVFHGWLQCDCRPFKQTLLNTIKRWSFLFKRYLNNHVINSLADLESFMNITRTALKKPLKEGDY 1116

  Fly  1216 EGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAAT 1280
            :|||:::..|.::.|:|...||||:|||:.|:||:.|..|..:....::.|||:.|...|:||..
Mouse  1117 DGLVEVMGHLMKVKERQVATDSMFEPLKQTIELLKSYGEEMPEEIYLKLQELPEQWTNTKKLAIQ 1181

  Fly  1281 TKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQ 1345
            .||.:||:|:.:|:::.::....:...:.:|:||.....|.......|:.:::....:.|:|...
Mouse  1182 VKQNVAPLQANEVNILRRKCQQFELKQHEFREKFRRDAPFSFSDPEPYKSLNKQQKSISAMEGVM 1246

  Fly  1346 RSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECK 1410
            .:|.:||.|||:..||..:::.|..:::|:|.:||..:.:.::|:|||.|.||.|::|.||.:||
Mouse  1247 EALCKSASLFEVTVPDYKQLKACHREVRLLKELWDMIVMVNTSIDDWKTTKWKDINVEQMDIDCK 1311

  Fly  1411 KFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDS 1475
            ||.:::|.|||.|:.|:.|:.::.::||::||||||:||||||||||||.:|||.|:|||.|.:.
Mouse  1312 KFAKDVRSLDKEMKPWDAFVGLDNTVKNMITSLRAVSELQNPAIRDRHWQQLMQATQVKFEMSEE 1376

  Fly  1476 TTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEE 1540
            |||.||:.||||:||:||:|||||:|||..|||.|:.:...|.||||..::|.||...:||:.|.
Mouse  1377 TTLADLLQLNLHKYEDEVRNIVDKAVKESGMEKVLKTLDITWTTMEFEHELHPRTGTMMLKSDEV 1441

  Fly  1541 LIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDI 1605
            |:|||||:|.||||:..|||::.|..||..||.:||.||.:|..||||||.|.:|||||||||||
Mouse  1442 LVETLEDNQVQLQNLMMSKYLSHFLKEVTSWQQKLSTADSVISIWFEVQRTWSHLESIFIGSEDI 1506

  Fly  1606 RSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLE 1670
            |:||||||:|||.||:|||||:.......|||.:||:  ..||..||.|...|.:|||||.:|||
Mouse  1507 RAQLPEDSKRFDAIDQEFKALMEDAVKTPNVVEATNK--PDLYNKLENLKMSLAVCEKALAEYLE 1569

  Fly  1671 TKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNL---ISGS--KNAAGMVAKE 1730
            ||||::|||||||||||||||||||:|..|:|||:||:||:.||..   .||.  |...||.:||
Mouse  1570 TKRLAFPRFYFVSSADLLDILSNGNDPVEVSRHLSKLFDSLCKLKFRLDASGKPLKFGLGMYSKE 1634

  Fly  1731 LEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQ 1795
             :|:|.|.:.||.||:|||||||:.|:||.|||.::..::..|:.|||..|||::|||.||..||
Mouse  1635 -DEFVDFDKECDLSGQVEVWLNRVLDRMRATLRHEIPEAVVTYEEKPREQWIFDYPAQVALTCTQ 1698

  Fly  1796 IMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDV 1860
            |.||||...|||::::.||||:||||||||:|||.||.||:|:|||.:|.|||||||||||:|||
Mouse  1699 IWWTTEVGLAFARLEEGYENAIKDYNKKQISQLNALITLLIGNLTAGDRMKIMTICTIDVHARDV 1763

  Fly  1861 VGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYI 1925
            |..:|..|||...||.||||||||||.:...|||||||||.:|.|||||||||||||||||||||
Mouse  1764 VAKMITAKVESSQAFTWQSQLRHRWDEEKKHCFANICDAQIKYSYEYLGNTPRLVITPLTDRCYI 1828

  Fly  1926 TLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWG 1990
            ||||||||:|||||||||||||||||||||||||.|||||||||||||||.|:|:||||||||||
Mouse  1829 TLTQSLHLIMGGAPAGPAGTGKTETTKDLGRALGTMVYVFNCSEQMDYKSCGNIYKGLAQTGAWG 1893

  Fly  1991 CFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPE 2055
            |||||||||||||||:||||||:||||::||:.|:||||.|:|..|||:|||||||||||.||||
Mouse  1894 CFDEFNRISVEVLSVIAVQVKCVQDAIRAKKKKFNFLGEIISLVPTVGIFITMNPGYAGRTELPE 1958

  Fly  2056 NLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKS 2120
            |||||:||||||||||.||.|||||||||.:||||||||||||||||||||||||||||||||||
Mouse  1959 NLKALFRPCAMVVPDFELICEIMLVAEGFLDARLLARKFITLYTLCKELLSKQDHYDWGLRAIKS 2023

  Fly  2121 VLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAV 2185
            ||||||:|:|.|..|.|||||||||||||||||||||:||||||||||||||||||||:..||.:
Mouse  2024 VLVVAGSLKRGDPTRAEDQVLMRALRDFNIPKIVTDDLPVFMGLIGDLFPALDVPRKRDLNFEKI 2088

  Fly  2186 IKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYND 2250
            ||:|.::||||.||.|:||:||||||..||||||:||.||:|||:|.|:|||||||.||||...|
Mouse  2089 IKQSIVELKLQAEDSFVLKVVQLEELLQVRHSVFVIGNAGSGKSQVLKSLNKTYQNLKRKPVAVD 2153

  Fly  2251 LNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDD 2315
            |:|||||.||||||:||:||||||||||.:|||.|||...|||||||||||||||||||||||||
Mouse  2154 LDPKAVTCDELFGIINPATREWKDGLFSTIMRDLANLTHEGPKWIVLDGDIDPMWIESLNTVMDD 2218

  Fly  2316 NKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSS 2380
            ||||||||||||.|.:.|||:|||:.|||||||||||||||||||.||||.|.:.||:..|...|
Mouse  2219 NKVLTLASNERIPLNRTMRLVFEISHLRTATPATVSRAGILYINPADLGWNPVVSSWIERRKVQS 2283

  Fly  2381 EVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYF 2445
            |.:.|.:|||||:|..||..|...:.|||:.:|..:|...|||:.:||.:|.|.|.||:.||:||
Mouse  2284 EKANLIILFDKYLPTCLDKLRIGFKRITPVPEITVIQTILYLLECLLTEKNAPPDSPKELYELYF 2348

  Fly  2446 VFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVPQF 2510
            ||...|.||.::||||:||:..|||||::||:|.:|.|..||||.:|||.|||||.|||:.||.|
Mouse  2349 VFACFWAFGGAMFQDQLIDYRVEFSKWWINEFKTIKLPSQGTIFDYYIDPETKKFLPWTDKVPNF 2413

  Fly  2511 ELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTN 2575
            |||.|:|||::||:|.||.|:|:|:|.|:|...|:||:|.:|:||::||..||..|.:|.|.|..
Mouse  2414 ELDPDIPLQASLVHTTETIRIRYFIDLLMEKAWPVMLVGNAGTGKSVLMGDKLENLSTDDYLVQA 2478

  Fly  2576 VPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMD 2640
            |||||||||.|||.:||||||||:||||||.|.|::|||:|||||||||||.||.|||||||.||
Mouse  2479 VPFNFYTTSAMLQGVLEKPLEKKSGRNYGPPGTKKLIYFIDDMNMPEVDKYGTVAPHTLIRQHMD 2543

  Fly  2641 YHHWYDRQKMTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQH 2705
            :.|||||||:||:|:|.|..||||||::||||||||||||||.|||:.|.|:||..|.|:||:||
Mouse  2544 HRHWYDRQKLTLKDVHNCQYVACMNPTSGSFTIDPRLQRHFCVFAVSFPGQEALTSIYNTILAQH 2608

  Fly  2706 MDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETC 2770
            :.  .:.....:.:|..::||.|:.||.||.::||||||||||.|||||::|||.|:|:|.:|..
Mouse  2609 LS--FRSAPLVIQRLSSHLVTAALALHQKVSATFLPTAIKFHYIFNLRDLSNIFQGILFSTAEIL 2671

  Fly  2771 PNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVYAQPLIYCHFAKGL 2835
            .....::|||:||..||||||:||..|..:..::....|:|..:.:.::.::|:|.|:|||.:|:
Mouse  2672 KTPLDLVRLWLHEAERVYGDKMVDEKDQETLHRVTIASVKKFFDDLGEENLFAKPNIFCHFTQGI 2736

  Fly  2836 TDIKYMPISGWDRLKSLLDEAQDRYNDYIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGG 2900
            .|.||.|::...:|..||.:..|.||:....||||||:||::|:|:|:|||||.||.|||:||||
Mouse  2737 GDPKYFPVTDVAQLNKLLKDVLDSYNEVNAVMNLVLFEDAVAHICKINRILESPRGNALLVGVGG 2801

  Fly  2901 SGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFL 2965
            ||||||:|||::||:||||||.|.|.|::.|||.::||.|:|:.||.....||||||:||.||||
Mouse  2802 SGKQSLSRLAAYISALDVFQITLKKGYAIPDLKMDLATQYIKSAVKNVPSVFLMTDSQVAEEQFL 2866

  Fly  2966 VLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPV 3030
            ||:|||||||:|..||.|:::|||::::|.:||.|||.|.||.|||:||||||..|||:||||||
Mouse  2867 VLINDLLASGEIPGLFGDEDLENIISSMRPQVKSLGIADTREACWKFFIEKVRRQLKVILCFSPV 2931

  Fly  3031 GATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVN 3095
            |:.||||:|||||:||||.|:||||||:.||.|||.|||.|...:..|:...:|.|||:||.|||
Mouse  2932 GSVLRVRARKFPAVVNCTAINWFHEWPEDALVSVSARFLEETEGIEPEVKTSISLFMAYVHTTVN 2996

  Fly  3096 DISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQD 3160
            ::||:||...:||||||||:|||.|.||..||.:|....:.:..||||||:||.|...:||.|:.
Mouse  2997 EMSKIYLTIERRYNYTTPKTFLEQIKLYQNLLAKKRMELVAKIERLENGLMKLQSTASQVDDLKA 3061

  Fly  3161 VLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKA 3225
            .|.|||.|||.||:.||.||.|||.|.||||||:|.|.:||..|..|.::||.|.|.||.|..||
Mouse  3062 KLAVQETELKQKNENADKLIQVVGVETEKVSKEKAIADEEEMKVEVINKNVTEKQKACETDLAKA 3126

  Fly  3226 QPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNV 3290
            :|||:||||||:|||||||||||||||||||||:|..||::|.:..||||||:||||.:..||.|
Mouse  3127 EPALLAAQEALDTLNKNNLTELKSFGSPPDAVVNVTAAVMILTAPGGKIPKDKSWKAAKIMMGKV 3191

  Fly  3291 DKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVE 3355
            |.|||:|..:||:||....:||.:||..:..|.||.|.:||:||||||||.|||.|||:||..|.
Mouse  3192 DTFLDSLKKFDKEHIPEACLKAFKPYQGNPTFDPEFIRSKSTAAAGLCSWCINIVRFYEVYCDVA 3256

  Fly  3356 PKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIA 3420
            ||.:||.|:..|:.:|::||:.:..::.||...|:.|...:::|.|:|.|||.||..|...|.:|
Mouse  3257 PKRQALEEANAELAEAQEKLSRIKNKIAELNANLSNLTSAFEKATAEKIKCQQEADATNRVISLA 3321

  Fly  3421 NRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNS 3485
            |||:||||:|.:||.|||:........|.||:|:||.|:||||.||:.||.||.||.|:|.....
Mouse  3322 NRLVGGLASENVRWAESVENFKSQGVTLCGDVLLISAFVSYVGYFTKKYRNELMEKFWIPYINKL 3386

  Fly  3486 QPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKT 3550
            :.|||.|:|:||..::.|||.:|.||||||||||||.|||.||..:||:||::|.|||||||:|.
Mouse  3387 KVPIPITEGLDPLTLLTDDADVATWNNQGLPSDRMSTENATILCNTERWPLIVDAQLQGIKWIKN 3451

  Fly  3551 KYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTVLKIGDREI 3615
            |||:.|..:||.|::|||.:|:|:|.|..||||||||.:||||:|||||..||||..:||||:|:
Mouse  3452 KYGSDLQAIRLGQKSYLDIIEQAISAGDTLLIENIGETVDPVLDPLLGRNTIKKGRFIKIGDKEV 3516

  Fly  3616 DFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQ 3680
            :::..||||||||..|||||||||||.|||||.||||||||||||.||..||||||.::..||:.
Mouse  3517 EYHPSFRLILHTKYFNPHYKPEMQAQCTLINFLVTRDGLEDQLLAAVVAKERPDLEQLKANLTKS 3581

  Fly  3681 QNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSARE 3745
            ||.|||.||.|||.||||||:|..|.|.|..||.|||.||.||:|||.||.|||||.|:|:.|||
Mouse  3582 QNEFKIVLKELEDSLLARLSAASGNFLGDTALVENLETTKHTANEIEEKVQEAKITEVKINEARE 3646

  Fly  3746 AYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCS 3810
            .|||||||||::|||||||.|||||||||||||.|||..|:.|...|:::|.||.||.|.||:..
Mouse  3647 NYRPAAERASLLYFILNDLNKINPIYQFSLKAFNVVFEKAIQKTAPADEVKQRVINLTDEITYSV 3711

  Fly  3811 FVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNFTWLTHVGWGGIRA 3875
            ::||:|||||:||||||.|:..|:|....|:.|.|||||||||:.....|...:|.|..||||:|
Mouse  3712 YMYTARGLFERDKLIFLAQVTFQVLSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQSWGGIKA 3776

  Fly  3876 LNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGKSAIQRLCIMRCIRPDRMSYAMRS 3940
            |:....||.|:.|||||.|||||.|:||:||.|.||.|||.|:|:|:||::||:|||||:||:::
Mouse  3777 LSEMDEFKNLDSDIEGSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLCMVRCMRPDRMTYAVKN 3841

  Fly  3941 FIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVS 4005
            |:|||:|||:::.||:|||::::||||.|.|||:||||||||||||.|||.|||:.|:...|:||
Mouse  3842 FVEEKMGSKFVEGRSVEFSKSYKESSPSTPIFFILSPGVDPLKDVEALGKKLGFTIDNGKLHNVS 3906

  Fly  4006 LGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPAGDP 4070
            ||||||:|||||:::|::.||||||||||||||||..|:||:|...|..|..||:|:|||||...
Mouse  3907 LGQGQEVVAENALDVAAEKGHWVILQNIHLVARWLGILDKKVERYSSGSHEDYRVFISAEPAPTA 3971

  Fly  4071 AAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAE 4135
            ..||:||||||:||||||||||||.||:|||||.|:.:|||||:||.|||.|||:||||||||||
Mouse  3972 ETHIIPQGILENAIKITNEPPTGMYANLHKALDLFTQDTLEMCTKEIEFKCILFALCYFHAVVAE 4036

  Fly  4136 RRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCR 4200
            |||||.||||||||||.||||||:.|||||||||::|||:|||||||||||||||||||||||||
Mouse  4037 RRKFGAQGWNRSYPFNNGDLTISINVLYNYLEANSKVPWDDLRYLFGEIMYGGHITDDWDRRLCR 4101

  Fly  4201 TYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVSE 4265
            |||.|:::.|:::||:....||..|..|.|.|||.|||:|||.|||.|||||.||||||||..||
Mouse  4102 TYLAEYIRVEMLEGEVLLAPGFQIPPNLDYKGYHEYIDENLPPESPYLYGLHPNAEIGFLTVTSE 4166

  Fly  4266 RLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVEDRSPYIIVAFQ 4330
            :|||.|.|:||:.| .|..|..||:|:.:|.:::|||:|.|..||:.|:|.:..:::||::||||
Mouse  4167 KLFRTVLEMQPKET-DSGAGTGVSREEKVKAVLDDILEKIPETFNMAEIMAKAAEKTPYVVVAFQ 4230

  Fly  4331 ECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFS 4395
            ||||||.|..|::|||.||:|||||||||::.||||...|:.|.||:.|...|||||:||.:|::
Mouse  4231 ECERMNILTNEMRRSLKELNLGLKGELTITTDMEDLSTALFYDTVPDTWVARAYPSMMGLAAWYA 4295

  Fly  4396 DLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEE 4460
            ||:.|:||||.|..||.:|:::||||||||||.||||||..|||||||||:|||:.:||||.:|:
Mouse  4296 DLLQRIRELESWTTDFALPTTVWLAGFFNPQSFLTAIMQSMARKNEWPLDKMCLSVEVTKKNRED 4360

  Fly  4461 LTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYK 4525
            :|..||||:|:.||||||||||.:.|.||:|.||:|.|.|||::|||:..|:.:.||:|||||||
Mouse  4361 MTAPPREGSYVYGLFMEGARWDTQTGVIAEARLKDLTPVMPVIFIKAIPVDRMETKNIYECPVYK 4425

  Fly  4526 IRLRGPTFVWTFNLKSRERASKWTLAGVCLLLQ 4558
            .|:||||:|||||||::|:|:||.||.|.||||
Mouse  4426 TRIRGPTYVWTFNLKTKEKAAKWILAAVALLLQ 4458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 141/588 (24%)
DHC_N2 1368..1770 CDD:285579 230/407 (57%)
P-loop_NTPase 1903..2132 CDD:304359 202/229 (88%)
P-loop_NTPase 2217..2352 CDD:304359 108/135 (80%)
P-loop_NTPase 2510..2783 CDD:304359 166/273 (61%)
P-loop_NTPase 2860..3127 CDD:304359 170/267 (64%)
MT 3140..3480 CDD:289543 190/340 (56%)
AAA_9 3509..3722 CDD:289547 143/213 (67%)
Dynein_heavy 3864..4549 CDD:281078 446/685 (65%)
Dnah17XP_006534213.1 DHC_N1 185..764 CDD:285571 143/597 (24%)
DHC_N2 1269..1673 CDD:285579 230/407 (57%)
P-loop_NTPase 1806..2036 CDD:304359 203/230 (88%)
P-loop_NTPase 2120..2255 CDD:304359 108/135 (80%)
P-loop_NTPase 2413..2684 CDD:304359 166/273 (61%)
P-loop_NTPase 2761..3028 CDD:304359 170/267 (64%)
MT 3040..3383 CDD:289543 191/343 (56%)
AAA_9 3410..3623 CDD:289547 143/213 (67%)
Dynein_heavy 3763..4449 CDD:281078 446/687 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1463at33208
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.