DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and si:dkeyp-86b9.1

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_009299843.1 Gene:si:dkeyp-86b9.1 ZFINID:ZDB-GENE-060531-163 Length:4626 Species:Danio rerio

Alignment Length:4732 Identity:1448/4733 (31%)
Similarity:2376/4733 (50%) Gaps:541/4733 (11%)


  Fly    79 RYKVAYFIR-----YLTPLHLTDENMLNSLLI--GDLLPNPLANLSILCDEVFFPLLNNTVNQVG 136
            :|.|.||:|     ...|:.:.:.|.|...||  |.:..:||..||.|.:.|:.|.|  :.||..
Zfish   184 KYNVLYFLRNTKETITEPVDINEANHLMPRLIEFGMMNDHPLKMLSGLLNHVYIPRL--SANQQR 246

  Fly   137 WTN----VIA----NDMKTESQEMRNGIAQMKG----------------LVINRTIFPLPICMDE 177
            .||    .:|    ||:...::..:....:.:|                .||::|:..|.   .|
Zfish   247 LTNGGYQGVAGSEDNDISKTTEGEKQQPVESRGSFEVRDDLLHSTHKFLQVIDQTLRQLE---GE 308

  Fly   178 VMQAAPAIAM-GDISVV--NPLMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSF 239
            .....|.|.: |::.:.  |.:|...||..|:.|    ...:.|...|:...|...|.|.|...|
Zfish   309 FKLHMPEIDLEGEVELFLSNSVMVDKLEQCVMNW----HTQITIVIEEQKRKKPQGPGPLAEIEF 369

  Fly   240 WESRLENLENLAEQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRK 304
            |..|:....:|.|||..:.:|.|..|:.:..|.......:....:.:...|:....:.|:.::|.
Zfish   370 WRERVAVFSSLIEQLNLQAVKKILEVMTRADSFIMQELEKTTAELRKYYDESVSNVQFLTTVERH 434

  Fly   305 MDKFETN-DMDENRSDIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIF 368
            .....|. |.......|..|:..:.::|..||.::|...|..........|.:.|.|.|:...:|
Zfish   435 FRNLVTGVDFKVVLETIPELINGLRMIWILSRCYNTDERMEALMERIAWELSERVARVVDVHVLF 499

  Fly   369 QGDVDEAYKKLDINMQHLEYYKLIYNECRNSLKKFKIGTTFNSQ---DWTWHQDEIFGRLDKFLV 430
            :.....|..|:....:.|:.:|..|.|.|..::        ||:   .|.:::.::|.:.|....
Zfish   500 KEKRVVAKAKVQDGKRVLDIWKACYFEVRARIE--------NSERDPRWEFNRRKLFEKTDYMAS 556

  Fly   431 RLEELKDLFNTVRDFQKL----EKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDA 491
            ..::|..:..|:.:|..:    .|.|.|..|      .::.:|...||:.:....:.::|.| :.
Zfish   557 ICQDLYSVLQTLDEFYIIFGPELKAVTGDPK------RIDDVLHCVNSLVKPIEEVTFDPFD-NR 614

  Fly   492 ENSLFQRDRLSFKAKTDVMERMV------SFQFEKGLEDTHDLLLA-GSLLLRPIIKKHVEPLMH 549
            :.:.::.....|..:..|:||..      ||:..:......||||. .::..|..|...:.....
Zfish   615 KMTSWKMVMQEFNNEVQVIEREAITFIDHSFKTLRSSSAAFDLLLKFKNIRCRDAINDQLMKKFS 679

  Fly   550 VIVDDFEEEIMCVKKEFINFKNVFTALGLNELPTDDCFPKVSGAISF----LKKLRHRIIGLHKE 610
            .|:..:.:|::.:...|:.||        :..|.....|.::|||.:    |.::|:.:....::
Zfish   680 DILAQYCKEMVLINDIFVKFK--------DNPPLSKNHPPMAGAIIWQRFLLDQMRYPMKRFRED 736

  Fly   611 HELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDITLTLI--------- 666
            .:     |.:|:.|..|...|..:...:..:...|.:||..:..|.:...:..:|:         
Zfish   737 RD-----LMNNQEGKAVESKFIEVASRMRQYEVDLYNKWKADTNQTLPILMRKSLLVMVNSYGTV 796

  Fly   667 -----------EKDEANELR--VNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARV 718
                       ||....::|  |||...|...:.:.|.:..:|..:...|.....:|:       
Zfish   797 CADSTRHRTGSEKVLERDVRFSVNFPPELQEIISEAKCLDRIGIVLPDELQNVALQEE------- 854

  Fly   719 KLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDF-------IKWNAFS-QRFIVMIFK 775
            ..:|..........|.|.....|..||.:|:.:|::.|...       |.||... .:||     
Zfish   855 VFLRYINGLKKLVRRYHLLMDNLNDAEFLLMADQVQELRQVLSVGCKRINWNNLGIPQFI----- 914

  Fly   776 MVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRL 840
                  .|...|....|:::..|:.       ..:|::          :.:.||.:||       
Zfish   915 ------QRGNQAASKFESLENQIQK-------NERDID----------DKLKSIESAN------- 949

  Fly   841 IDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLE 905
                       .|..|.             .:..|..|.|              ||.      .|
Zfish   950 -----------LFKFPL-------------ADQTGYLPGI--------------REF------CE 970

  Fly   906 EFEEEQSESEEEIITPF--------HRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSS 962
            ..|.|::::...::..:        ....|:.|.|..:.....::..|.:..|.::|     |..
Zfish   971 FIESERAKTVNLLVNMYAAISPLLTKMESLIMGTSTGKAKGMAQFYAYWERKIFDSL-----TKM 1030

  Fly   963 TYLRMEVDN-RYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRV 1026
            .:..::..| ....|||:|:|...|..|.:                   .:|...:.:..|:::.
Zfish  1031 VFQNIQAFNTALMGNTPLFQIDTILAAPEI-------------------ALLPKSSEVYKLIRQC 1076

  Fly  1027 AQDPTEVT------------NMNP-----------YSFYDELQDKSELDKQRVEIMNKIKLALQA 1068
            ..|..|.|            ...|           ::||.::....::::|...:...|:..|..
Zfish  1077 VGDCVETTKRFVRWMHGSCIQCPPQHVDGEDESFLFTFYSDICQLPQINEQATAVSQTIQRLLNG 1141

  Fly  1069 VRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKE 1133
            :.|:.|.:|.:.|||..||:..:   :||                        ..:.|...:|.|
Zfish  1142 ISVYLKSWMSYRSLWKLDKAIVM---EKF------------------------AAKKPSCVMYDE 1179

  Fly  1134 QLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWI-SLFKL-------DLINRVKN 1190
            :...::::.:::......:...: :|||:.....||...:..|: ||.||       :|.| ::|
Zfish  1180 KFQFYVKVSNEVAKQPMVKHEHI-IRLNLEPLARAVQENIQVWVTSLGKLLNDSAREELFN-LRN 1242

  Fly  1191 SLKELQDFVDEANIVLKIELQK--DDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYN 1253
            .|           ::|...|::  :..|.|..:|..:..|.:.....:...:..:|....|..|.
Zfish  1243 EL-----------LILSENLKRSPNTLEDLKFVLVTITDIRDMSLSVEMRINDAQERYRTLSMYI 1296

  Fly  1254 YEFKDTELAQINELPDAW-------MKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTY- 1310
            .|..:.|:.....:...|       .:|.|.....|:..|.|...|::..::.:.:.....|.: 
Zfish  1297 VETTEEEMQLSANISILWNDLFMESRQVDRSLVKVKKTFAEITLNQIEEYKQELFIFAESFNMHG 1361

  Fly  1311 -------RKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLFEL---QGPDPVKI 1365
                   .:|.|.       .:|.||      .|||.:|.|::.||::..||.|   ..|:.:.:
Zfish  1362 PGAVGDDLEKGLQ-------IMSTYE------TELVRVEARRQELAKAEKLFNLPITMYPELLNV 1413

  Fly  1366 ELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFI 1430
            :.   :::.::.:::...:.:....:|.:|.|..:||:.:.:....|.:.||.|.|..|......
Zfish  1414 QK---EMRGLRQIYEIFKSQKEAKTEWSQTLWVNLDIQLLQEGIDGFIKSLRKLPKDARALPVSF 1475

  Fly  1431 FMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDST-TLKDLIDLNLHEYEEEVK 1494
            |:|..:|....||..:.:|:|.|:|:|||..||:.|...|.|:.:| ||:::..:.||:|...:.
Zfish  1476 FLEGRMKEFRESLPLLLDLKNKALRERHWKSLMERTGTNFEMNPNTFTLENMFAMELHKYGNVIS 1540

  Fly  1495 NIVDKSVKEMAMEKQLRDIATAWGTMEF-------GTDIHDRTSIKLLKASEELIETLEDHQGQL 1552
            .||..:|||:.:||.::::...|.:|:|       ||..|.    .:|.|.:::::.|:|....|
Zfish  1541 EIVTSAVKELGIEKGVKEVEETWDSMKFTVHRYFKGTQEHG----FILGAVDDILQHLDDDAMNL 1601

  Fly  1553 QNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFD 1617
            |:||.|.::..|...|:.|:..||...:.|..|..||:||.||||||||. ||||||||::::||
Zfish  1602 QSMAGSHFVGPFLATVQQWEKNLSLISETIEVWMLVQQKWMYLESIFIGG-DIRSQLPEEAKKFD 1665

  Fly  1618 YIDKEFKALLAQMNADRNVVRS---TNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRF 1679
            .|||.||.::.....|..:.|.   .||...     |:.|...|..|:|:|||||::||.::|||
Zfish  1666 NIDKTFKKIMTDTVKDPGIKRCCLVPNRLAD-----LQNLSDGLERCQKSLNDYLDSKRNAFPRF 1725

  Fly  1680 YFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLISGSK---------NAAGMVAKELEEYV 1735
            :|:|..:||.||.: :.|..|..|:.|:||::..|...:|..         :|.|.| .||::.|
Zfish  1726 FFISDDELLSILGS-SEPTCVQEHMIKMYDNIAALRFDTGMNGEMVANALVSAEGEV-MELKQPV 1788

  Fly  1736 PFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDH-KPRHVWIFEWPAQPALVGTQIMWT 1799
            |      ..|:||.|:..:..:||.|.|...|.::.||.| |.|..|:.::.....|...|:.||
Zfish  1789 P------AEGRVEDWMTAVLLEMRRTNRLITKEAIYFYSHQKSRVDWMLDYQGMVVLATNQVWWT 1847

  Fly  1800 TETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTI 1864
            .|..|.|.::.:..:.|||.|.||...|:|:|:..:...|...:|:||.|:..||||:||:|.:.
Zfish  1848 YEVEDVFRRMNEGEKQALKQYAKKMHQQINDLVKRITEPLKKNDRRKINTVLIIDVHARDIVDSF 1912

  Fly  1865 IAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQ 1929
            :...:.....|:|:||||..|..:.|:.|...|.|||.|.|||:|...||||||||||.|:||||
Zfish  1913 VRDSITDAREFEWESQLRFYWVKEPDELFVRQCSAQFCYGYEYMGLNGRLVITPLTDRIYLTLTQ 1977

  Fly  1930 SLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDE 1994
            :|.:.:||||||||||||||:||||.:|||::..|.||.|.|||.::|.|..||||.||||||||
Zfish  1978 ALSMFLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKILSGLAQCGAWGCFDE 2042

  Fly  1995 FNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKA 2059
            ||||...||||::.|::.|::|:....|.|.|.|:.|:|...:|:|||||||||||.||||::||
Zfish  2043 FNRIDASVLSVISSQIQTIRNALMLHLQRFHFEGQEISLDNRIGIFITMNPGYAGRTELPESVKA 2107

  Fly  2060 LYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVV 2124
            |:||..::|||...|.||||.:|||..|::||:|...||.|.:|.||||.|||:||||:|||||:
Zfish  2108 LFRPVVVIVPDLQQICEIMLFSEGFLVAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVM 2172

  Fly  2125 AGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEF----EAV 2185
            ||.|:|......||.||||||||.|:||.|.:|||:|:|||.||||.||.||.|.|.|    ||:
Zfish  2173 AGELKRGSPNLSEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPSFNDAVEAI 2237

  Fly  2186 IKRSALDLKLQPEDGFIL------KIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKR 2244
            ::          |:.:|:      |:||:.|....||:..::|..|.|||.|..||.::......
Zfish  2238 LE----------ENRYIMMPSQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQSQTRLGL 2292

  Fly  2245 KPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRD-QANLGGTGPKWIVLDGDIDPMWIES 2308
            ......|||||::..||:||::|.||:|.||:.|.:.|| .........::|:.|||:|.:|:|:
Zfish  2293 LTKLYSLNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINKPTDKKERRYILFDGDVDALWVEN 2357

  Fly  2309 LNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWL 2373
            :|:||||||:||||:.|||.|.....||||:..|:.|:||||||.|:::::|::|.:.|:.:.|:
Zfish  2358 MNSVMDDNKLLTLANGERIRLQSHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWEKWV 2422

  Fly  2374 GTRTNSSEVSMLNVLFDKYVPPLLDIF---------RTRLRSITPISDIARLQMTCYLLDSMLTP 2429
            .:|....:..:.. ||:||||..:|:.         ..:|:::...:|:..:.....::||:|..
Zfish  2423 NSRAPKEKADLCK-LFEKYVPSAIDMIVDGVVDGKQTEKLKTVILQTDLNMVMQLTVMVDSLLEN 2486

  Fly  2430 QNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAV-----KFPLSG--- 2486
            :    |...:..|..|:..:....|:||     :|...:....|:.:..::     :..|:|   
Zfish  2487 E----DFLFEELECCFLEALYCSLGASL-----LDKGRQKFDAFIKKLSSLNSVHDEKVLAGPGE 2542

  Fly  2487 ------TIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPL 2545
                  |::.|:.|...||:.||:::|.::..:.::.....||.|.:|||..:.::.:::...|:
Zfish  2543 IPVYLPTLYDFHFDGTQKKWVPWSSMVSKYIHNPEMKFIDILVPTVDTTRANWLLEQMVKVKRPV 2607

  Fly  2546 MLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKR 2610
            :|:|.||:.||..:...||.|.:|...:..:.|:..|||..|||.||..:||:....:||...||
Zfish  2608 VLVGESGTSKTATIQNFLSNLNTDTTIMMTINFSSRTTSMDLQRTLEANVEKRTKDTFGPPMGKR 2672

  Fly  2611 MIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQK-MTLRDIHKCNIVACMNPSAGSFT-I 2673
            ::.|:||:|||.||:|.|.||..|::..:|....|||.| :..:.|.....:|.|..:.|... :
Zfish  2673 LLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNYKLIKDLGFIAAMGKAGGGRNEV 2737

  Fly  2674 DPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSS 2738
            |||....|..|.:..|.:::|..|.:|||..|    .:.|::.:..:|:.:....:.|:..::..
Zfish  2738 DPRFISLFSVFNIPFPEEESLHLIYSSILRGH----TKPFEECIRNICDKLTFCTLELYKTIIKD 2798

  Fly  2739 FLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKK 2803
            ..||..||||.|||||::.::.|:..:|.|......|.:|:|.:||.||:.|:|::.||....:.
Zfish  2799 LPPTPSKFHYIFNLRDLSRVYHGLTLTNPERFCTVTQFVRVWRNECLRVFHDRLINETDKIMVQG 2863

  Fly  2804 IVSDIVRKGIEGVNDDVVYAQPLIYCHFAKGLTDIK--YMPISGWDRLKSLLDEAQDRYNDYIGA 2866
            .|.::|.:..:...|..: ..|:::..:...|....  |..|..:|..|:|..|..:.||:....
Zfish  2864 HVKNLVEEHFKSDLDSAM-RDPILFGDYRTALKSEPRVYEDILDYDASKALFQEILEEYNENKTK 2927

  Fly  2867 MNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSD 2931
            |||||||||:.|:..|.||:...||:|||:|||||||||||:||:|.:..:||:|.|::.||.::
Zfish  2928 MNLVLFDDALEHLTVIHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGYEVFEIVLSRGYSETN 2992

  Fly  2932 LKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNE 2996
            .:.::.|||:|.|::.....||.||:.||.|.||.|:|::|.||.:..||.|||.|:::|.:|:|
Zfish  2993 FRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDE 3057

  Fly  2997 VKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQAL 3061
            ..:.|...::|:.|:||:.|..:.|.:||..||||.|||.|.|.||.|||.|:||||..||.|||
Zfish  3058 AMKSGCGPSKESIWQYFVNKSANNLHIVLAMSPVGDTLRTRCRNFPGLVNNTSIDWFSPWPLQAL 3122

  Fly  3062 ESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKL 3126
            .:|:..||.|..::||..:..|.:.:..||.:|.|.|||:|...:|.||.|||::|:.|..||.|
Zfish  3123 YAVAKSFLGESPMIPKSHSEAVIDHVCMVHSSVGDYSKLFLQTLRRSNYVTPKNYLDFINTYSNL 3187

  Fly  3127 LHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVS 3191
            |.:|.|..|.:..|||.||.||...:.::..|...|..|:|.|..|....:.|:..:........
Zfish  3188 LEDKDKYILAQYKRLEGGLDKLKEASGQLAELNVKLDEQKVVLAEKTSACEILLEEICANTAVAE 3252

  Fly  3192 KERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDA 3256
            :::..|.::.|.:.:..:.:..:.|..|....:|.|||.||:.||..|:|:::||::||..||..
Zfish  3253 EKKTLAEEKAKEIEEQNKVIVVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFTKPPKQ 3317

  Fly  3257 VVSVCGAVLVLFSSKGKIPKDRSWKACRAFM--GNVDKFLDNLINYDKKHIHPDVIKALQPYILD 3319
            |.:||..:||:   :|.  |:.:||..:..|  ||   ||.:|:..|...|:.:.:|.::.|:.:
Zfish  3318 VQTVCECILVI---RGY--KEINWKTAKGMMSEGN---FLRSLMEMDCDSINANQVKHVKAYLRN 3374

  Fly  3320 AEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTE 3384
            ...|.|::...|.|.:|:..:|..:..:.:|...::||...:...|:....::.:|..:...|..
Zfish  3375 LNTSLEEMQGISKAGSGMLRFVEAVMGYCEVARDIKPKREKVARLERNFHQSKRELERIQNELGA 3439

  Fly  3385 LEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLP 3449
            ::::|.||..:|:.|:.:||..|:||......:..|::||.|||:|..||::.::.|.....:|.
Zfish  3440 IQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLL 3504

  Fly  3450 GDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPF---EMICDDAQIAEWN 3511
            ||.||.:.|:||.|.|:..:|.|:..|:|.........|:.     .||   .::.|:.:|:.|.
Zfish  3505 GDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLS-----QPFRIENLLTDEVEISRWG 3564

  Fly  3512 NQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTK-YGTGLVVLRLSQRNYLDQVERAVS 3575
            ::|||.|.:|.:|..:..:|.|:||.||||.|.:.|||.| ....|.:...:..::|..:|.|:.
Zfish  3565 SEGLPPDELSVQNGILTTRSSRFPLCIDPQQQALNWVKKKEEKNNLKISSFNDPDFLKGLELAIK 3629

  Fly  3576 NGSVLLIENIGENIDPVLNPLLGRQLIKKGT----VLKIGDREIDFNSRFRLILHTKLANPHYKP 3636
            .|...|.:::.|.||||::.:|.:.:  ||.    |:.:||:|:|::..|:|.|:||||||.:.|
Zfish  3630 YGFPFLFQDVDEYIDPVIDNVLEKNI--KGAEGRQVVVLGDKEVDYDPNFKLYLNTKLANPKFLP 3692

  Fly  3637 EMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSS 3701
            .:..:..:||:|||..|||||||:.:|..||.:||..|.||..:.:..|..||.|||.||..|::
Zfish  3693 AVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLILETSENKRLLKDLEDSLLRELAT 3757

  Fly  3702 AGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFK 3766
            :..|:|::|.|:..|::||..|:|:..|:..|:.|.|.||:.|:.|||||:|.::::|:|.::..
Zfish  3758 STGNMLDNVELIQTLDETKSKANEVFEKLKLAEKTAVDIDTLRDGYRPAAKRGAVLFFVLAEMAL 3822

  Fly  3767 INPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLC 3831
            ::.:||:||.:|..||:.::.|::....|..|::|:||::|...:.|...||||:.||:|...:.
Zfish  3823 VSSMYQYSLASFLEVFDLSLSKSLPNPILPSRLKNIIDTLTQNVYNYGCTGLFERHKLLFSFNMT 3887

  Fly  3832 IQILVNLGEVEPTELDFLLRFPYMPNQTSN---FTWLTHVGWGGIRAL----NNQAVFKGLEKDI 3889
            |:|....|.....||:|..:......::..   ..||...||..|..|    .|:  |..|..||
Zfish  3888 IKIEQAEGRAPQDELEFFFKGNLSLEKSKRKKLLDWLPDQGWEDIIRLMELFPNE--FGTLADDI 3950

  Fly  3890 EGSHKRWKKFVDSESPENEKFPGEWK-GKSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDA 3953
            |.:.:.||.:.|.::||...||.::| ..|..|:|.::||.|.||:..|:..::...:|.||:..
Zfish  3951 EKNPEEWKNWYDLDAPEQASFPMKYKENLSPFQKLLLIRCFRLDRVYRAVSDYVTLTMGEKYVQP 4015

  Fly  3954 RSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAI 4018
            ..:.|...|::|||.:.|.|:||||.:|..|:.||.|..||..:...|  :::|||||.||...:
Zfish  4016 PVISFEAIFDQSSPNSPIVFILSPGSEPASDLMKLAKHSGFGVNRLKF--LAMGQGQEKVAFQLL 4078

  Fly  4019 EIASQYGHWVILQNIHLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESA 4083
            :.|...|.|::|||.||:.:||..|||.:| .::..|..:||:|:.||..|     .|.|||:.:
Zfish  4079 DTAVARGQWLMLQNCHLLVKWLRDLEKTLE-RITKPHPDFRLWLTTEPIKD-----FPIGILQKS 4137

  Fly  4084 IKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSY 4148
            :|:..|||.|:..|:.......|.:.|..|: ...|:::::.|.:|||||.||||:|..|||..|
Zfish  4138 LKVVTEPPNGLKLNMRATYFKISHDKLMNCA-HPAFRSLVYVLAFFHAVVQERRKYGKIGWNVPY 4201

  Fly  4149 PFNVGDLTISVYVLYNYL-----EANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQ 4208
            .||..|..:.:.:|..||     :.:..:||..|:||.||:||||.:.|.:|||:...|.:|::.
Zfish  4202 DFNESDFLVCMEILDTYLTKAQNQGDEIIPWGSLKYLIGEVMYGGRVIDSFDRRILTVYTDEYLG 4266

  Fly  4209 PELID----------GELEYCQGFPAPGILKYTGYHNYID--DNLP-SESPSLYGLHSNAEIGFL 4260
            ..:.|          .:::|  ..||.|..:.     |:|  ::|| :.:..::|||.|||||:.
Zfish  4267 DFIFDTFQPFHFFHNADVDY--KIPALGPKQV-----YVDEIESLPLANTAEVFGLHPNAEIGYY 4324

  Fly  4261 TTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNI--------LELMGR 4317
            |..:..::..:.||||: ||.|.||  :|:::.|..:..||..|.|..|::        ||:   
Zfish  4325 TQAARDMWTHLIELQPQ-TGDSGGG--ISRDEYISQVARDIQSKLPEVFDLDVIRKKLGLEI--- 4383

  Fly  4318 VEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKL 4382
                ||..:|..||.||.|.|...:.|||.||...|.||:.:||.::::...|:..|:|..|.||
Zfish  4384 ----SPTSVVLLQELERFNKLTVRMSRSLAELQRALAGEVGMSSELDEVARALFNGQIPVIWRKL 4444

  Fly  4383 AYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRM 4447
            |..::..|.:|......|..:...||.:.. |..:||:|...|:|.|||::|.|.|||.||||..
Zfish  4445 APDTLKSLGNWMIHFKRRHEQYSSWVNEGE-PYVMWLSGLHIPESYLTALVQATCRKNGWPLDHS 4508

  Fly  4448 CLNCDVTK-KWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQD 4511
            .|...||: ..::::...|.:|.:::||::|||.||:..|.:..:..:.|...:|:|.|..:...
Zfish  4509 TLYTQVTQYSSEDQVKERPGQGCFVSGLYLEGADWDIDNGCLVRSKPRVLVSQLPILKIIPIEAR 4573

  Fly  4512 KQDIKNVYECPVYKIRLR----GPTFVWTFNLKSRERASKWTLAGVCLLLQT 4559
            :..::|....|||...:|    |...|:..:|.:.:..|.|.|.||||.|.:
Zfish  4574 RLKLQNTLRTPVYTTSMRRNAMGVGLVFEADLYTTKHISHWVLEGVCLCLNS 4625

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 119/614 (19%)
DHC_N2 1368..1770 CDD:285579 139/422 (33%)
P-loop_NTPase 1903..2132 CDD:304359 140/229 (61%)
P-loop_NTPase 2217..2352 CDD:304359 59/136 (43%)
P-loop_NTPase 2510..2783 CDD:304359 86/275 (31%)
P-loop_NTPase 2860..3127 CDD:304359 127/267 (48%)
MT 3140..3480 CDD:289543 99/342 (29%)
AAA_9 3509..3722 CDD:289547 85/218 (39%)
Dynein_heavy 3864..4549 CDD:281078 243/721 (34%)
si:dkeyp-86b9.1XP_009299843.1 DHC_N1 332..913 CDD:312031 119/620 (19%)
MT 1135..4268 CDD:330758 1129/3258 (35%)
DHC_N2 1417..1816 CDD:312039 139/417 (33%)
Dynein_heavy 3922..4622 CDD:308587 248/729 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.