DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and LOC567790

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_009290539.1 Gene:LOC567790 ID: Length:4466 Species:Danio rerio

Alignment Length:4602 Identity:2076/4603 (45%)
Similarity:2974/4603 (65%) Gaps:183/4603 (4%)


  Fly     1 MADEKEKKEPVDNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSG 65
            |::|:|.....|.|.::....|.:.:.||.|.|.|.:...:.:.:...|... :.:.:.|::.:.
Zfish     1 MSEEEETAFSEDPRVQYLGETLCRMLNLKADTWVKFVNAEKNKTLFTAFFET-HIRVLFFSVTAS 64

  Fly    66 GQLYPSYSFPVRPRYKVAYFIRYLT-PLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFPLLN 129
            ..|..|.......:.|..|.::... |:|  .||..:.||.|.|..:.|..||...::|..|||:
Zfish    65 KALDVSTEVCHLSKDKKVYVLKKGNGPIH--PENCGSFLLFGVLSTSFLPQLSDTMEKVCLPLLS 127

  Fly   130 NTVNQVGWTNVIANDMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDISVVN 194
            |..|...|.||::.|:|...:.:::.:..:||....:||.|:|...:.:.|...|..|...| .|
Zfish   128 NKKNHQMWPNVVSQDVKQHIENLQSRVTVVKGQYYGKTILPVPAIREWIEQCQEATVMLHDS-RN 191

  Fly   195 PLMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRI 259
            ..|.|:.|.||:.|...:..::...:.|.|....| |.|:....||.||..|::::.|||.:..:
Zfish   192 RAMIHAAESMVISWTHMIHKVLREDSTELIVKGLN-PGPKTELDFWRSRKMNIQSINEQLQNPCV 255

  Fly   260 KTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLM 324
            :.:..:||.|.|.:..|::.::|.|.::|.|||.|...|.||...:.|.|.::.....:.|.|:.
Zfish   256 QKMMRILEIIDSSYFPSFKALMEAVFDALQEARAIDLHLQPLGSLLSKLEKSEFPSFPALIPPVF 320

  Fly   325 LTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINMQHLEYY 389
            ..|.|||.|..::.:...:........|..|...:..:..|.:.:.:.::|.:|:...:.     
Zfish   321 HLIFLVWTHCSFYRSPARIVSLLQELCNFFIQQASSHLRADELLKSETEDALEKIQTVLG----- 380

  Fly   390 KLIYNECRNSLKKF--KIGTTFN----SQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKL 448
              ::...|.:.|.:  |:....|    ::.|.:....:|.|.|..|.|:.:||.||.|:.:||:|
Zfish   381 --VFGCVRETFKTYRQKVAALTNHYSSAKCWDFPSALVFTRFDSILARVLQLKALFTTMLEFQRL 443

  Fly   449 EKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTDVMERM 513
            ||:|.|||:||..|..:.::.:|:..:.:...:.:|||:|..:::  |::|..||:.|....:|.
Zfish   444 EKLVFGGLRGRVYTEQVSRLHKEFLLLCKAIKDQEYNPLDLSSQD--FEKDFSSFQEKVADFDRQ 506

  Fly   514 VS------FQFEKGLEDTHDLLLAGSLLL-RPIIKKHVEPLMHVIVDDFEEEI-MCVKKEFINFK 570
            :|      ||...|||....|:.....|| |.|||:...|....:.:.|.:|: .|        |
Zfish   507 LSNILCLAFQDCSGLESVFKLVTVFKPLLDRDIIKESFIPKFFEVTELFGKELNKC--------K 563

  Fly   571 NVFTA----LGLNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEYPLFDNERGGYVSDI- 630
            ::|.|    ...|:|..:...|.::|::.:.|.||.||          :.| ::|.|  :|.|: 
Zfish   564 HLFDAHLEQKKRNKLHLNKNMPAMTGSLKWAKMLRDRI----------QIP-WNNFR--FVLDMK 615

  Fly   631 ------------FNIMVQEIDDFTKMLLDKWTVECWQGIQQDITLTLIEKDEANE-LRVNFTERL 682
                        :..|...:|::.|.:..:|..:.....|.::...||::|...: |.||..:.|
Zfish   616 MEGAEIELALHNYQEMSSLLDEYEKQVYLRWCGDINHVCQMNLDQPLIKRDHTTDLLSVNVNQEL 680

  Fly   683 IFALKDIKVVRLLG-CDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEM 746
            |..|||:|.:::.. .::.....|.:......::....|..:.||||...:.....|..|:..||
Zfish   681 IAVLKDVKHLKMFNQMNIPSAAMKVYENRQIFFEKLGSLHLLVEWYNKVKQTTLEVEAPLLKEEM 745

  Fly   747 ILIEEQMKPLLDFIKWNA-FSQRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQRK 810
            ..|::|:......:.|.. .|..:|.|:...|..|..||...::|:|.||..::.|.|...|.||
Zfish   746 KTIDQQIHRAETELTWQTENSWNYICMLKHTVYQLERRLQKTKDNIEMIKAQMKGWSKHLTFCRK 810

  Fly   811 DLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDG 875
            |....::|..:.:..|::....|......:|..|:..|:..|                       
Zfish   811 DHKKDMVLQLEDKATIVAQSYRNIRKDAEIIHNLLQENIMFF----------------------- 852

  Fly   876 IWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFR 940
                                             |..|.|:|                      ::
Zfish   853 ---------------------------------EADSSSDE----------------------WK 862

  Fly   941 EYEIYVDEIIAENLVDSVITSSTYLRMEVDNR--YENNTPIFEIFMELQEPNVVYFRNLDTSSKT 1003
            .|..|||:::.|.....:   ||.|...::|.  .....|:||..|.|....:.:..:||.....
Zfish   863 AYLEYVDDMVVEGFFKVI---STSLEFFIENMGGSVRQAPLFEAQMLLMGSEIQFKPSLDRDGGD 924

  Fly  1004 GFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQA 1068
            |....:|.:|.|:..|.:.:||||  |..:..    .:..:::|..:|...|.|||.|::..||.
Zfish   925 GLYELVEELLGDVFKMSAQVKRVA--PHLIVE----DYQADVEDMLDLLDLRQEIMEKVEEVLQK 983

  Fly  1069 VRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSV-YK 1132
            ...:...|..:|.||:.|::.:|.:...:|..||.:|.:|    .|.....    |.||.:. :|
Zfish   984 ALQYQDTFNRYSPLWLDDRAEFLRQFLLYGHVLTAEEVEA----YGEDAFP----ENPPTTAQFK 1040

  Fly  1133 EQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQD 1197
            :|::.:.|:..::...|.::.|..:.|:::..||:::|:.:.:|..:||..|::.|.||:.||::
Zfish  1041 KQMNHYEEVHREVSHLEDWQVFDGWFRVDIRSFKMSLLNIIKKWSWMFKEHLMSFVTNSIGELEE 1105

  Fly  1198 FVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELA 1262
            |:::|...||..:...|::.||::...|..|..:|...:.:|:|::|:::||.|:.....|:...
Zfish  1106 FMEQAESRLKEPVCSGDYQALVEVKGFLLAIRNRQHNTERLFEPVREMVNLLEQFGETLPDSIYI 1170

  Fly  1263 QINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSC 1327
            |:.|||:.|..:|:.|.|.|..:||:.:.:|.:|.::.:..:.....:|.||.::..........
Zfish  1171 QLEELPEKWNSLKKFAWTVKHEVAPLHNAEVVIIRRKCVAFEKKLYQFRGKFRTEAPLQYNTDKP 1235

  Fly  1328 YELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDW 1392
            |..:|:..:|::||||....|.||..|||:..||..::.||:.|..::|.:||..:..||:|:.|
Zfish  1236 YACLDKCHMEMLALEEENADLQESCKLFEVSSPDTKQLRLCQRDNAVLKQLWDLLLCAQSSISAW 1300

  Fly  1393 KKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDR 1457
            ..|.|::|::|.|:.|.::|.:|:|.|||..|.|:.::.:|..|.:|:.||||||||.|||:|||
Zfish  1301 TGTKWREINVEQMETELRRFTKEMRVLDKEARVWDVYVGLERVLSDLLASLRAVTELLNPAMRDR 1365

  Fly  1458 HWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEF 1522
            ||.:|:.||.|.|::...|||:||:.|.||.||:.|.:.|.|:|:|::.||.|.:|:..|..|||
Zfish  1366 HWAQLISTTGVDFTLSKGTTLEDLLALQLHRYEDVVHSTVGKAVREISTEKVLTEISQMWARMEF 1430

  Fly  1523 GTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFE 1587
            ..:.|.||:|.:||.|:||:|:||:.|.|||.:..||...||..:|...|.:|:.||.::..|.|
Zfish  1431 VYEEHYRTAIPMLKCSDELLESLEESQVQLQVLLHSKQAVFFHEQVLELQAQLTQADSVLLLWLE 1495

  Fly  1588 VQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLE 1652
            |||.|.:|||||:.||||:.||||::::|..||.:||.|:.:....|||:.:|||  ..|...||
Zfish  1496 VQRTWAHLESIFMSSEDIQQQLPEEAQQFCSIDSDFKNLMFKNGNTRNVIAATNR--PNLLPTLE 1558

  Fly  1653 ILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLI 1717
            .|.:.|.:|||||..|||.||:::|||||:||||||||||.|:.|..|..||.||:|||..|...
Zfish  1559 DLQRRLSVCEKALAKYLEAKRMAFPRFYFLSSADLLDILSKGHQPRQVTCHLGKLFDSMTDLQFS 1623

  Fly  1718 --SGSK--NAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPR 1778
              .|.|  :|.||.::: .|||.|..:|||.|.||:|||.:.|.|::.:|..:..::..|:.:.|
Zfish  1624 DKEGGKATSAVGMFSRD-GEYVSFFSSCDCVGPVELWLNCLEDVMKEGVRRFIAEAVVMYEERSR 1687

  Fly  1779 HVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAE 1843
            ..|:.|.|||..|..:||.|:.:.|.||.::.:.:|.||:|||||||.|||:||.:|||:|...:
Zfish  1688 EHWVLELPAQVVLTASQIWWSADMNLAFERLAEGFETALRDYNKKQIAQLNSLINMLLGELNPGD 1752

  Fly  1844 RQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYL 1908
            ||||||:||||||:||||..:||:||....||.|.|||||.|:.:...||.|||:|||||.||||
Zfish  1753 RQKIMTLCTIDVHARDVVSKLIAQKVSSAQAFAWVSQLRHSWNDEQKHCFINICNAQFRYSYEYL 1817

  Fly  1909 GNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDY 1973
            |||||||||||||||||||||||||.|.|||||||||||||||||||||||:|||||||||||||
Zfish  1818 GNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDY 1882

  Fly  1974 KSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVG 2038
            ||||:|.||||||||||||||||||:||||||||||||.|.|||:::.:...||.|.|:|:.::|
Zfish  1883 KSIGNIFKGLAQTGAWGCFDEFNRIAVEVLSVVAVQVKTIHDAIRNQSKRILFLEEEISLKPSIG 1947

  Fly  2039 VFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKE 2103
            :|||||||||||.|||||||||:|||||||||..||.||||::||||.|::|..||||||.||||
Zfish  1948 IFITMNPGYAGRTELPENLKALFRPCAMVVPDMELICEIMLMSEGFQSAQILGNKFITLYRLCKE 2012

  Fly  2104 LLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDL 2168
            ||||||||||||||:|.||.|||||||.||.||||||||:||||||:||::::|||||:|||.||
Zfish  2013 LLSKQDHYDWGLRAVKPVLAVAGALRRADRTRPEDQVLMQALRDFNMPKMISEDVPVFLGLIRDL 2077

  Fly  2169 FPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWK 2233
            ||.|:|.|..:.|||.::::::.:|||||||.||.|:||||||.:|.||||:||.||||||::.|
Zfish  2078 FPGLEVERGIDAEFEHLVRQTSQELKLQPEDTFIQKVVQLEELLSVHHSVFVIGEAGTGKSQILK 2142

  Fly  2234 TLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLD 2298
            ||:|||.|..|||.:||||||:::||||||..:|:||||||||.|..|||||:...:||||||||
Zfish  2143 TLHKTYFNMGRKPFWNDLNPKSMSNDELFGFFHPATREWKDGLLSHFMRDQASNSHSGPKWIVLD 2207

  Fly  2299 GDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDL 2363
            ||||||||||||||||||||||||:||||.||..|||||||:.||.|||||||||||||||||:|
Zfish  2208 GDIDPMWIESLNTVMDDNKVLTLANNERIPLTPSMRLLFEISHLRHATPATVSRAGILYINPQEL 2272

  Fly  2364 GWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLT 2428
            .|:..:.||:..|...:|.:.|.:|||||:|..::..|:..::|.||.:.:.:|..|.|||.:||
Zfish  2273 SWSLSVMSWIDRRERQTERAHLTILFDKYIPRCIEKMRSSFKTIIPIPENSMVQTLCSLLDCLLT 2337

  Fly  2429 PQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYI 2493
            |:|:|.|.|::.||:||||..||.||.:..|||:.|:..|||:|::.|.|:||||:.|::|.|.:
Zfish  2338 PENIPADSPRELYEMYFVFACVWAFGGATVQDQLHDYRAEFSQWWIKEMKSVKFPVQGSVFDFCL 2402

  Fly  2494 DHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTIL 2558
            |..:|:|.|||:.:|.||:|.|:|:|:.||.|.||.||::.|..|::|..|:||:|.:|:|||.:
Zfish  2403 DPHSKRFVPWTDRIPAFEMDPDIPVQAVLVPTVETVRLQYLMSMLLKASQPVMLVGGAGTGKTAV 2467

  Fly  2559 MNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEV 2623
            :...|..|| :.:..|.||.:||||:.|||:.:|||||:||||::.|..|||::||:|||||..|
Zfish  2468 VKNLLETLP-ENFITTKVPLHFYTTALMLQKEMEKPLERKAGRSFAPPRNKRLLYFIDDMNMAAV 2531

  Fly  2624 DKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNP 2688
            |.|.|.|||.||||.:||.||||.||:|::||:..:.|:||||::|||||:|||||||...||:.
Zfish  2532 DSYGTSQPHALIRQHLDYQHWYDSQKLTMKDINNTDYVSCMNPTSGSFTINPRLQRHFTVLAVSS 2596

  Fly  2689 PSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLR 2753
            ||::.|..|..|||:.|:.  |..|..||::....::..|:|||.:|:..|||::.||::.|||.
Zfish  2597 PSRETLSSIYGSILNIHLQ--ILPFSPAVMRCSAFVLKAALTLHERVLQHFLPSSSKFYHLFNLW 2659

  Fly  2754 DIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVND 2818
            |::.||.|:|:|..|.......:.:|||||..|||.|:..:.:|:..|.:...||.|:..|.:.:
Zfish  2660 DLSRIFQGLLFSRPECVKRGADLFQLWIHESRRVYSDRFSEPSDLQMFLRFQVDIARQASEEIEE 2724

  Fly  2819 D-VVYAQPLIYCHFAKGLTDIKYMPISGWDRLKSLLDEAQDRYNDYIGAMNLVLFDDAMSHVCRI 2882
            | |::.:|:||.|.:.|..:..|.|:|||:.|..:|::|.:.||:....||||||.:||.|||||
Zfish  2725 DSVLFQEPVIYLHSSLGSAESSYKPVSGWEHLTCVLNDALNNYNELHSTMNLVLFQEAMQHVCRI 2789

  Fly  2883 SRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKT 2947
            ||||...||:||||||||||||||||||:.:|::||||.:|:|.|.:.|||.::|.||:|.|||.
Zfish  2790 SRILACPRGHALLIGVGGSGKQSLTRLAAHLSNMDVFQPKLSKGYGIQDLKMDLARLYIKTGVKN 2854

  Fly  2948 SACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKY 3012
            .....|:||:::..:||.|:::.|::||:|.:|..::|||.:..||::||:.||::||.||||::
Zfish  2855 IPTVLLLTDAQIPEDQFFVIISTLISSGEIPDLLSEEEVEGVRKAVKSEVRDLGLLDNNENCWRF 2919

  Fly  3013 FIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPK 3077
            |:.:||..||||||.||||..||:|.|:||||::|||:|||.||||:||:||||::|.||..:..
Zfish  2920 FMNRVRHQLKVVLCMSPVGNALRLRVRRFPALLSCTTLDWFQEWPQEALQSVSLKYLQEIPSIEP 2984

  Fly  3078 ELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRL-RL 3141
            .:...:|.|||..|.:|..:|:.|..|.||:||:|.|||||.:.||..||..:.| .|.:|| ||
Zfish  2985 TIWESISLFMAHAHTSVKRVSERYCCNEKRHNYSTSKSFLEQLRLYKSLLENREK-ELHQRLDRL 3048

  Fly  3142 ENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQ 3206
            ::||.|:.|...:|:.|...|..|||||.:|||.|:.|:..:|.:.|:||::|..|..||:.|..
Zfish  3049 QSGLQKIKSTASQVEDLTVKLNSQEVELTMKNQAAEALMARIGLQTERVSQKREDADLEEQKVAA 3113

  Fly  3207 IEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSK 3271
            ::.:|:.:.|.||:|..||:|||.||..||.||||.||||||:|.:||:||::|..||:||.:.:
Zfish  3114 MQAEVSRRLKECEKDLAKAEPALDAATAALQTLNKVNLTELKTFPNPPEAVINVTAAVMVLLAPR 3178

  Fly  3272 GKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKAL-QPYILDAEFSPEKILAKSSAAA 3335
            |:|||||.|||.|.|||.||.||..|::|||:||....:..: |.|:.:.||.|:.:..||.|||
Zfish  3179 GQIPKDRGWKAARVFMGKVDDFLQALLSYDKEHIPQSCLNVVKQEYLKNPEFHPDHVRTKSYAAA 3243

  Fly  3336 GLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEAL 3400
            |||:|:|||.|:|:||..|.||..||.::..|::.|..||.::..:|.:|:..|.:|..:::.|.
Zfish  3244 GLCAWIINIVRYYEVYCEVAPKRLALAQANSELETATTKLLSVRRKLEDLDRHLQSLTAQFERAA 3308

  Fly  3401 AKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCF 3465
            .:|.:||:|.::|:.||.:||||:|||..|.:||.|....|...::.:.||:||.:.|:||.|.|
Zfish  3309 TEKLRCQEEVTRTSQTIKLANRLVGGLQAENVRWSEGQLELEGQLKTVCGDVLIAAAFVSYAGYF 3373

  Fly  3466 TRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQ 3530
            |:.||.:|...:.:|..:..:.|:|.|||:||..|:.|.|.:|.|.|||||:||:|.||||||..
Zfish  3374 TQPYRHQLLHDMLIPFLRELRTPVPLTDGLDPVLMLTDQATVAGWQNQGLPADRLSIENAAILKS 3438

  Fly  3531 SERYPLMIDPQLQGIKWVKTKYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNP 3595
            |:|:||::|||.|..||::..||..|.||:..|:.|||.:|:|::.|.|:||||:.|.:||:|.|
Zfish  3439 SQRWPLIVDPQQQASKWIRNLYGPSLRVLQYGQKGYLDVIEQALACGEVVLIENMKERVDPLLEP 3503

  Fly  3596 LLGRQLIKKGTVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLA 3660
            |||||.:|||..:::||:|.:::..|||:||||.||||:.||:|||||||||||||.|||||||.
Zfish  3504 LLGRQTLKKGRYIRLGDKECEYDKGFRLLLHTKQANPHFPPELQAQTTLINFTVTRSGLEDQLLG 3568

  Fly  3661 EVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADE 3725
            :||..|||:||.|:..|:.|||..:|.||.|||:||::||:|..|.|.|..||..||.||.||..
Zfish  3569 QVVTQERPELEMMKLELSTQQNLCQIELKRLEDELLSKLSAAEGNFLRDTALVEQLEHTKNTARH 3633

  Fly  3726 IEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAM 3790
            |:.|...|:...::.:.||:.||||||||:::|||:.:|..:||:||:|||||..||..|:.:|.
Zfish  3634 IQNKAVAARENEIKTNEARDLYRPAAERAALLYFIIKELHNVNPMYQYSLKAFNKVFLKAIARAP 3698

  Fly  3791 AAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYM 3855
            :.|.:..||.:|.:|||..:..||.:|||::|:|.|||...:|:|:..|.::..:|:.|||||..
Zfish  3699 SDEDVSVRVLSLTESITHSALQYTCQGLFQRDRLTFLTHTALQVLLMRGFIDGEDLEILLRFPVE 3763

  Fly  3856 PNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGKSAI 3920
            ..::|..::|:...||.|::::.|..|:||::|:|||.|||||.|:||.||.|:||.:||.||.:
Zfish  3764 ICESSPVSFLSPQAWGAIKSISMQDAFRGLDRDVEGSAKRWKKLVESECPERERFPQDWKTKSPL 3828

  Fly  3921 QRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDV 3985
            |||.|:|.||||||:||:|:|||:.||.||:....|||.:.|||.||.|.:||:|||||:|:|||
Zfish  3829 QRLIILRAIRPDRMTYALRNFIEDSLGPKYVHISHMEFEKCFEECSPTTPVFFILSPGVNPVKDV 3893

  Fly  3986 EKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESS 4050
            ||||..|||:.|..|||:||||||||.|||.|:|.|::.||||:||||||:::||..||:.:|::
Zfish  3894 EKLGLKLGFTTDRGNFHNVSLGQGQETVAEIALETAAKNGHWVMLQNIHLLSQWLSRLEEMLENT 3958

  Fly  4051 LSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSK 4115
            .||.|::||:|:|.|||.:|..|::|:.|||:::|:|.||||||.:.:|.||||||.:||||||:
Zfish  3959 ASNAHSNYRVFMSGEPAPNPHEHLIPRTILENSLKLTTEPPTGMNSTLHAALDNFSKDTLEMCSR 4023

  Fly  4116 ETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYL 4180
            |.|||.::||||||||.|:|||||||||||..||||.|||.||..||||||||:|:||||||.||
Zfish  4024 EQEFKGLMFSLCYFHACVSERRKFGPQGWNHKYPFNNGDLNISANVLYNYLEASTKVPWEDLCYL 4088

  Fly  4181 FGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPSES 4245
            ||||:|||||||:.||.||||||:||:.|::.:|||..|.|||||..|.|:.||.|:|:.|||||
Zfish  4089 FGEIIYGGHITDERDRMLCRTYLQEFINPKMFEGELFLCPGFPAPPDLDYSEYHRYVDERLPSES 4153

  Fly  4246 PSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFN 4310
            |:|:.||.||||.|:|..||.||:.:.||||| ...::.|.|...|:.::::::::|:|.|..:|
Zfish  4154 PALFRLHPNAEIEFMTATSESLFKTLLELQPR-DSTTAEGATQYTEEKVRSVVDELLEKLPEEYN 4217

  Fly  4311 ILELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQV 4375
            :.|||.:...||||::|..|||||||.|:..:..||.||.|.|||||::||.||.|...|:.|.|
Zfish  4218 VAELMSKTAQRSPYVLVCLQECERMNLLLEHIHTSLKELHLALKGELSLSSDMELLQTALFYDVV 4282

  Fly  4376 PEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKN 4440
            ||.|::|.:||...|..||||::.:.|||:.|..||..|:.:|::|.|:|||.||||||..||||
Zfish  4283 PESWSRLTFPSTKTLPQWFSDVLAQCRELDTWTHDFVFPAVVWISGLFSPQSFLTAIMQSIARKN 4347

  Fly  4441 EWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYI 4505
            :|||::|.|:.|||||.|::....|||||||:||::||||||...|.:::|.||:|.||||||||
Zfish  4348 KWPLNKMSLSVDVTKKSKDDYGHPPREGAYIHGLYIEGARWDCSSGLLSEAVLKDLTPAMPVLYI 4412

  Fly  4506 KAVTQDKQDIKNVYECPVYKIRLRGPTFVWTFNLKSRERASKWTLAGVCLLL 4557
            :||..|:||:||.||||||:.:.||.|::|:|.||:....:||.|||..|||
Zfish  4413 RAVPVDQQDLKNTYECPVYRTKQRGTTYIWSFPLKTHHPPAKWVLAGTALLL 4464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 150/599 (25%)
DHC_N2 1368..1770 CDD:285579 188/406 (46%)
P-loop_NTPase 1903..2132 CDD:304359 187/229 (82%)
P-loop_NTPase 2217..2352 CDD:304359 102/135 (76%)
P-loop_NTPase 2510..2783 CDD:304359 134/273 (49%)
P-loop_NTPase 2860..3127 CDD:304359 145/267 (54%)
MT 3140..3480 CDD:289543 152/341 (45%)
AAA_9 3509..3722 CDD:289547 123/213 (58%)
Dynein_heavy 3864..4549 CDD:281078 394/685 (58%)
LOC567790XP_009290539.1 DHC_N1 193..769 CDD:285571 151/607 (25%)
DHC_N2 1276..1679 CDD:285579 188/406 (46%)
P-loop_NTPase 1812..2041 CDD:304359 187/229 (82%)
P-loop_NTPase 2126..2261 CDD:304359 102/135 (76%)
P-loop_NTPase 2419..2689 CDD:304359 134/273 (49%)
P-loop_NTPase 2767..3034 CDD:304359 145/267 (54%)
MT 3046..3390 CDD:289543 153/344 (44%)
AAA_9 3418..3630 CDD:289547 123/212 (58%)
Dynein_heavy 3770..4456 CDD:281078 394/687 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1463at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.