DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and DNAH7

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_061720.2 Gene:DNAH7 HGNCID:18661 Length:4024 Species:Homo sapiens

Alignment Length:4076 Identity:1289/4077 (32%)
Similarity:2015/4077 (49%) Gaps:505/4077 (12%)


  Fly   773 IFKMVKYLHDRL----VAAQENLEAIKESIRSW-----GKVPLFQRKDLNPALLLHTDPREP-IL 827
            |.:...|:|..:    ||..|:         ||     ..||...:...:..:.|..:.||. :|
Human   161 ILRYYYYIHHGIDTDHVAPMED---------SWLEHVLDLVPQHLKVFTDSIVTLSDEMREDYLL 216

  Fly   828 SIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGI-------------W-- 877
            |:|       :.::|.::               ..|.|.| :|:::|.:             |  
Human   217 SVR-------KSIVDFVL---------------KDPREKG-DDKKTDELPAHRAEMEILPKPWRK 258

  Fly   878 -----------------PPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRY 925
                             |.::::..:....|||.|.|     |::||...|...|          
Human   259 SFLAASSYIRDHLNAMNPTMLAVLDLWHTNFKKLRLV-----DIKEFHNCQDALE---------- 308

  Fly   926 ELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFEIFMELQEPN 990
                 ||..:..:.|.             :||  ...|.|:|              .|.|:|  |
Human   309 -----LSSFQNIIMRH-------------MDS--AKETLLKM--------------WFPEVQ--N 337

  Fly   991 VVYFRNL-------DTSSKTGFAFF-----IETI-LDDMN--NMMSLLKRVAQDPTEV------- 1033
            :.|..|.       |:|:|.. :||     :.|: |.|:.  :|......:||.|..|       
Human   338 IYYQGNKKKQLPTGDSSAKLE-SFFNCAAALMTLQLQDLTLVSMQDFTDLIAQPPDSVRAFEHPG 401

  Fly  1034 ------TNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLS 1092
                  .:.:...|..||.|..::.....::|  ||......||..|.:.:      |:..:..:
Human   402 FIMRLILDNDTIKFEPELSDYIDIFLNVYDVM--IKAVSFVPRVETKLYSK------WESKSKPT 458

  Fly  1093 EVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQ-----DQIRTWETYE 1152
            .:|....|..:|                         .:||::.:.|..:     :.:|.::.| 
Human   459 TLKPIILNEIVD-------------------------AHKEKIKEVIMKESVAPTEHLRLYDKY- 497

  Fly  1153 DFFV----------FLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQ----------- 1196
            ||.:          ||..|.:..|:              :|.|.:.:..::|:|           
Human   498 DFLITRKAERDVDNFLAENHSYEKI--------------IDEICKYQKLIEEIQYTSIKTIRLGM 548

  Fly  1197 ----------DFVDEANIVLKIELQK-------------DDFEGLV-KILS-------------- 1223
                      ..|..|:|:....|.|             |:||.:. |.||              
Human   549 FEMHCEELIRALVKRADIICGKLLAKMFRDHQEVNTRLCDEFERIAEKALSTPPNTAELMEMKAY 613

  Fly  1224 -----VLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQ 1283
                 |.:.|..:|.:.||     |..:..|.:| ..|...::...|.:...:.::..:....::
Human   614 IQKVEVTDMIELEQRLVDS-----KNCLAFLIEY-VNFSPADMRLNNSVFQWYGRMGEIFEEHRK 672

  Fly  1284 LI-APIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRS 1347
            :| ..|:.||    |...|.|:.               ||..|..|....|.......|::.||.
Human   673 IIKEKIEQYQ----EGLKLRCER---------------FVEELESYAKQSEEFYSFGDLQDVQRY 718

  Fly  1348 LAESAVLFELQGPDPVKIELCRFDLKLVKI--------------------------------MWD 1380
            |.::.:   |.|         :.||...||                                :::
Human   719 LKKAQI---LNG---------KLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYE 771

  Fly  1381 FAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLR- 1444
            .|:...|....|.:.|:.|:   |.||.....|...|||.|..:|:....:..|..|.:.:.:. 
Human   772 TAVEFSSNYRAWTEGPYHKV---NPDQVEADIGNYWRGLYKLEKTFHDSPYALAMTKKVRSKVED 833

  Fly  1445 ------AVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKE 1503
                  .:..:.||.:|.|||..:...........|.:|:...:|:||..|.:..:.|.:.:.||
Human   834 FKQHIPLIQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVSSFLDMNLEPYIDRFEGISEAASKE 898

  Fly  1504 MAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEV 1568
            .::||.:..:.|.|..:||....:..|...:|.:.:|:...|:||..:.|.|..|.:|..:|.::
Human   899 YSLEKAMEKMITEWDAVEFVIHSYRETGTFILASVDEIQMLLDDHIIKTQTMRGSPFIKPYEKQM 963

  Fly  1569 RLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNAD 1633
            |.|:.:|....:|:..|.:||..|.|||.|| .|.||.||:||:.|||..:||.::.::..:..|
Human   964 REWEGKLLLLQEILDEWLKVQATWLYLEPIF-SSPDIMSQMPEEGRRFTAVDKTWRDIMRSVMQD 1027

  Fly  1634 RNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPA 1698
            ::|:  |..:..::.|.|:...::|.|..|.||:|||.|||.:|||:|:|:.:||:|||...:|.
Human  1028 KHVL--TVVTIDRMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPT 1090

  Fly  1699 LVARHLTKLYDSMGKLNL-----ISGSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKM 1758
            .|..||.|.::.:.|:..     |:..|::.|    |:.|.:..:......|:||.||..:...|
Human  1091 RVQPHLKKCFEGIAKVEFTETLDITHMKSSEG----EVVELIEIISTAKARGQVEKWLVELERVM 1151

  Fly  1759 RDTLRDQLKRSLTF-YDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNK 1822
            .:::. ::....|| |....|..|:.:||.|..|..:||.||.|...|.....:..|..||..|:
Human  1152 INSIH-KVTGDATFAYTKYERINWVRDWPGQTVLCVSQIFWTKEVQTAIPMGIKALEQYLKTCNR 1215

  Fly  1823 KQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDP 1887
                |:::::.|:.|.|:...|..:..:..:|||:|||:.:::.|.:...:.|:|.||||:.|..
Human  1216 ----QIDDIVTLVRGKLSMQNRVTLGALVVLDVHARDVLSSLVKKNISDDSDFEWLSQLRYYWQE 1276

  Fly  1888 KIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTK 1952
              :.....:.:|..||.||||||:|||||||||||||.||..:|||.:||||.||||||||||||
Human  1277 --NHLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTK 1339

  Fly  1953 DLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAI 2017
            ||.:|:.....|||||:.:||.::|...|||...|||.||||||||.:|||||||.|:..||..|
Human  1340 DLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGI 1404

  Fly  2018 KSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAE 2082
            .:......|.|..:.|..|..||||||||||||:|||:|||||:|..||:|||:|:|:||:|.:.
Human  1405 NAGADILMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSC 1469

  Fly  2083 GFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRD 2147
            ||..||.|:.|.:..|.||.|.||.|.|||:|:||:||||..||.|:.......|:.:|:|::.|
Human  1470 GFVTARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIID 1534

  Fly  2148 FNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELF 2212
            .|:||.::.|:|:|.|:..||||.:.:|:....:..|.||.:...:.||....|..||:|:.|:.
Human  1535 VNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIKDNCASMNLQMTAFFSEKILQVYEMM 1599

  Fly  2213 AVRHSVFIIGFAGTGKSEVWKTLNKTYQN-------QKRKPHYNDLNPKAVTNDELFGIVNPSTR 2270
            .|||...|:|....||:..::.|.....:       ::.|.....||||:||..:|:|..:..:.
Human  1600 IVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDSVSH 1664

  Fly  2271 EWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRL 2335
            ||.||:.::..|..|:......||::.||.:|.:|||::|||:||||.|.|.|.|.|.::.:|.|
Human  1665 EWSDGVLAVSFRAFASSVTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNL 1729

  Fly  2336 LFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEV---SMLNVLFDKYVPPLL 2397
            :||...|..|:||||||.|::|:.|..|||.|.:.||:.....|..|   ..:..|||:.||..:
Human  1730 IFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMLSWVNLLPASVSVIQKEFIMGLFDRMVPVSV 1794

  Fly  2398 DIFRTRLRSITPISDIARLQMTCYLLDSML------TPQNVPNDCPKDWYEI---YFVFCIVWGF 2453
            :..|...:.::|.||...::....|:|..:      ......||  ::.|.:   .|:|.::|..
Human  1795 EFIRKHTKELSPTSDTNLVRSLMNLIDCFMDDFADEVKLKERND--RETYSLLEGIFLFSLIWSV 1857

  Fly  2454 GSSLFQDQIIDWS--------NEFSKWFLNEYK-------------AVKFPLSGTIFSF-YIDHE 2496
            |:|...|..:.::        :..|....|.:|             .|.||..|||:.: ::...
Human  1858 GASCTDDDRLKFNKILRELMESPISDRTRNTFKLQSGTEQTSSKALTVPFPEKGTIYDYQFVTEG 1922

  Fly  2497 TKKFFPWTNLVPQF-ELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTI-LM 2559
            ..|:.||...:.:. .:..|:.....:|.|.:|.|....|:.|.....|.:.:||:|:||:: :.
Human  1923 IGKWEPWIKKLKEAPPIPKDVMFNEIIVPTLDTIRYSALMELLTTHQKPSIFVGPTGTGKSVYIT 1987

  Fly  2560 NAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVD 2624
            |..|:.|..:.|....:.|:..||:...|.|:...|:|:....:||...|||:.||||:|||..:
Human  1988 NFLLNQLNKEIYKPLLINFSAQTTAAQTQNIVMSKLDKRRKGVFGPPLGKRMVVFVDDVNMPARE 2052

  Fly  2625 KYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFT-IDPRLQRHFCSFAVNP 2688
            .|....|..|:||::|:.:|||.:..::..:....|:..|.|..|... :.||..|||....:|.
Human  2053 VYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNPVTPRYMRHFNIITINE 2117

  Fly  2689 PSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLR 2753
            .|..:::.|.:.||:.|:: ...||....:.|...:|...:||:.:.:.:.|||..|.||.||||
Human  2118 FSDKSMYTIFSRILTWHLE-ICYKFPDEFLDLTTQIVNGTMTLYKEAMKNLLPTPAKSHYLFNLR 2181

  Fly  2754 DIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVR-------- 2810
            |.:.:..||..|..||...:..:.|||:||..|||.|:|:|.||.:.....:.:|:|        
Human  2182 DFSRVIQGVCLSRPETTETTEVIKRLWVHEVLRVYYDRLLDNTDRSWLINYIQEILRNYMYEDFH 2246

  Fly  2811 ---KGIEGVNDDVVYA---QPLIYCHF-AKGLTDIKYMPISGWDRLKSLLDEAQDRYNDYI-GAM 2867
               :.::..||.:|.|   :.|::|.| .....|..|..|:..|.|:.:::...:.||:.. ..|
Human  2247 ELFQRLDFDNDGMVEADDLRSLMFCDFHDPKREDTNYREIADVDNLRMIVEIHLEEYNNISKKPM 2311

  Fly  2868 NLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDL 2932
            |||||..|:.|:.||||||:..|.:|||:||||||:||:||||:.::...|||::::|.|..::.
Human  2312 NLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSVFQVEISKGYDTTEW 2376

  Fly  2933 KANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEV 2997
            ..::..:..|.........||.||:::..|.||..|::||.:|:|..||..||.:.|.:.:|...
Human  2377 HEDLKVILRKCAEGEMQGVFLFTDTQIKEESFLEDVSNLLNAGEIPNLFALDEKQEICDKMRQLD 2441

  Fly  2998 KQLGIVDNREN----CWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQ 3058
            :|.......:.    .:..||:..||.|.|||..||:|...|.|.|||||||||.|||||..||:
Human  2442 RQRDKTKQTDGSPIALFNMFIDHCRSQLHVVLAMSPIGDAFRNRLRKFPALVNCCTIDWFQSWPE 2506

  Fly  3059 QALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALY 3123
            .||::|:.|||.||. :.:|:.....:.....|.:..|:||.:....:||||.||.|:||||:.:
Human  2507 DALQAVASRFLEEIE-MSEEIRDGCIDMCKSFHTSTIDLSKSFFVELQRYNYVTPTSYLELISTF 2570

  Fly  3124 SKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENE 3188
            ..||.:|....:..:.|.|.||.||.|.:.:|..:|..|:....:||:.::|.|.::|::..|:.
Human  2571 KLLLEKKRSEVMKMKKRYEVGLEKLDSASSQVATMQMELEALHPQLKVASKEVDEMMIMIEKESV 2635

  Fly  3189 KVSKERAFASKEEKNVRQIEEDVTAKA--KLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFG 3251
            :|:|.......:|....  |:.:.:||  ..|:.|...|.|.|.:|..||:||...::|.:||..
Human  2636 EVAKTEKIVKADETIAN--EQAMASKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMK 2698

  Fly  3252 SPPDAVVSVCGAVLVLFSSKG-KIPK--------DRSWKACRAFMGNVDKFLDNLINYDKKHIHP 3307
            |||..|..|..|:.:|...|. |||.        :..|...:..:|:: :||.:|..|||.:|.|
Human  2699 SPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDM-RFLQSLHEYDKDNIPP 2762

  Fly  3308 DVIKALQP-YILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDA 3371
            ..:..::. ||.:.:|.||||...|:||.|||.|||.::.:..|..:|.||:..|..:|.|:|.|
Human  2763 AYMNIIRKNYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELKIA 2827

  Fly  3372 RDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWME 3436
            .|.|......|.|::::|..||...:....||...:::....:..::.|.:|||||..||.||..
Human  2828 MDGLRKKQAALKEVQDKLARLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSH 2892

  Fly  3437 SVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMI 3501
            :...|......|.|||||.|..::|:|.||..|||. |.|.|....|...  ||.:|.......:
Human  2893 TALELGQLYINLTGDILISSGVVAYLGAFTSTYRQN-QTKEWTTLCKGRD--IPCSDDCSLMGTL 2954

  Fly  3502 CDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKT-KYGTGLVVLRLSQRN 3565
            .:...|..||..|||||..|.:|..|::.:.|:|||||||.|..||:|. :....|.|::||:.:
Human  2955 GEAVTIRTWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQSQANKWIKNMEKANSLYVIKLSEPD 3019

  Fly  3566 YLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKG--TVLKIGDREIDFNSRFRLILHTK 3628
            |:..:|..:..|:.:|:||:||.:||:|.|||.:|..|:|  |.:::||..|::...||..:.||
Human  3020 YVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTK 3084

  Fly  3629 LANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLED 3693
            |.||||.||...:.||:||.:|.:|::||||..||..||||||..:..|..|....|..||.:||
Human  3085 LRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVAQERPDLEEEKQALILQGAENKRQLKEIED 3149

  Fly  3694 DLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIY 3758
            .:|..|||:..|:|||.|.:..|..:|..|:||..|...|:.|..:||:.|..|||.|..:||::
Human  3150 KILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDTTRMGYRPIAIHSSILF 3214

  Fly  3759 FILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDK 3823
            |.|.||..|.|:||:||..|..:|..::..:..:|.|..|::.|.|..|:..:|...|.|||:||
Human  3215 FSLADLANIEPMYQYSLTWFINLFILSIENSEKSEILAKRLQILKDHFTYSLYVNVCRSLFEKDK 3279

  Fly  3824 LIFLTQLCIQILVNLGEVEPTELDFLLRFPY-MPNQTSNF-TWLTHVGWGGIRALNNQAVFKGLE 3886
            |:|...|.|.:|::...:...|..|||.... :.|..:|. |||....|..|..|::...||.:.
Human  3280 LLFSFCLTINLLLHERAINKAEWRFLLTGGIGLDNPYANLCTWLPQKSWDEICRLDDLPAFKTIR 3344

  Fly  3887 KDIEGSHKRWKKFVDSESPENEKFPGEWKGK-SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKY 3950
            ::.......|||..||..|.:|.||.||:.| :..||:.|:||:|||::...::.||..:||..:
Human  3345 REFMRLKDGWKKVYDSLEPHHEVFPEEWEDKANEFQRMLIIRCLRPDKVIPMLQEFIINRLGRAF 3409

  Fly  3951 IDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAE 4015
            |:....:.::.|.:|:....:.||||||.||:..:.|.....|:.  .....|:||||||..:|.
Human  3410 IEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMAALLKFADDQGYG--GSKLSSLSLGQGQGPIAM 3472

  Fly  4016 NAIEIASQYGHWVILQNIHLVARWLPSLEKKMES-SLSNVHTSYRLFLSAEPAGDPAAHILPQGI 4079
            ..:|.|.:.|.||:|||.||...|:|:|||..|. |..:.|..:|::|::.|:.:     .|..:
Human  3473 KMLEKAVKEGTWVVLQNCHLATSWMPTLEKVCEELSPESTHPDFRMWLTSYPSPN-----FPVSV 3532

  Fly  4080 LESAIKITNEPPTGMMANIHKA--LDNFSD-ETLEMCSKETEFKAILFSLCYFHAVVAERRKFGP 4141
            |::.:|:|||.|.|:.|||.::  :|..|| |....|.|..|||.:|:.||:|||:|.|||||||
Human  3533 LQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGP 3597

  Fly  4142 QGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEF 4206
            .|||..|.||..||.|||..|:.:|.....:|:|.|||:.||..|||.:|||||||..|:.|.:|
Human  3598 LGWNIPYEFNETDLRISVQQLHMFLNQYEELPYEALRYMTGECNYGGRVTDDWDRRTLRSILNKF 3662

  Fly  4207 MQPELIDGELEYCQGFPAPGI--LKYTGYH-NYID--DNLP-SESPSLYGLHSNAEIGFLTTVSE 4265
            ..|||::.. :|  .|.:.||  :..:|.| :||:  ..|| :.:|.::|:::||:|....:.::
Human  3663 FNPELVENS-DY--KFDSSGIYFVPPSGDHKSYIEYTKTLPLTPAPEIFGMNANADITKDQSETQ 3724

  Fly  4266 RLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVEDRSPYI----I 4326
            .||..:...|.|    |:|....|.::::..:..|||.|.|..|:|...|.|..  :.|.    .
Human  3725 LLFDNILLTQSR----SAGAGAKSSDEVVNEVASDILGKLPNNFDIEAAMRRYP--TTYTQSMNT 3783

  Fly  4327 VAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQ 4391
            |..||..|.|.|:..::.|...:...:||...:|:.:|:::..:...::||.|...:|||:..|.
Human  3784 VLVQEMGRFNKLLKTIRDSCVNIQKAIKGLAVMSTDLEEVVSSILNVKIPEMWMGKSYPSLKPLG 3848

  Fly  4392 SWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKK 4456
            |:.:|.:.||:.|:.|. :...|...||:|||..|:.||...|..|||...|:|.:..:.:|.: 
Human  3849 SYVNDFLARLKFLQQWY-EVGPPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDYEVME- 3911

  Fly  4457 WKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYEC 4521
             .:|....|.:|.:|:|||::||.|:.|:..:|::..|.|:..:||:::|...:.....:..|..
Human  3912 -DKEYKHPPEDGVFIHGLFLDGASWNRKIKKLAESHPKILYDTVPVMWLKPCKRADIPKRPSYVA 3975

  Fly  4522 PVYKIRLR---------GPTFVWTFNLKSRERASKWTLAGVCLLLQ 4558
            |:||...|         ...||....|.|.:....|...||.||.|
Human  3976 PLYKTSERRGVLSTTGHSTNFVIAMTLPSDQPKEHWIGRGVALLCQ 4021

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571
DHC_N2 1368..1770 CDD:285579 120/446 (27%)
P-loop_NTPase 1903..2132 CDD:304359 138/229 (60%)
P-loop_NTPase 2217..2352 CDD:304359 51/142 (36%)
P-loop_NTPase 2510..2783 CDD:304359 86/276 (31%)
P-loop_NTPase 2860..3127 CDD:304359 111/272 (41%)
MT 3140..3480 CDD:289543 118/352 (34%)
AAA_9 3509..3722 CDD:289547 94/216 (44%)
Dynein_heavy 3864..4549 CDD:281078 242/709 (34%)
DNAH7NP_061720.2 Stem. {ECO:0000250} 1..1289 288/1314 (22%)
DHC_N2 763..1162 CDD:285579 116/410 (28%)
P-loop_NTPase 1290..1520 CDD:304359 138/230 (60%)
AAA 1. {ECO:0000250} 1290..1511 135/221 (61%)
AAA 2. {ECO:0000250} 1571..1802 82/231 (35%)
P-loop_NTPase 1604..1747 CDD:304359 52/143 (36%)
AAA 3. {ECO:0000250} 1938..2189 77/252 (31%)
P-loop_NTPase 1942..2211 CDD:304359 86/270 (32%)
AAA 4. {ECO:0000250} 2302..2555 100/254 (39%)
P-loop_NTPase 2303..2574 CDD:304359 111/272 (41%)
Stalk. {ECO:0000250} 2572..2873 93/304 (31%)
MT 2586..2933 CDD:289543 117/351 (33%)
AAA 5. {ECO:0000250} 2954..3184 98/230 (43%)
AAA_9 2962..3178 CDD:289547 94/216 (44%)
Dynein_heavy 3322..4012 CDD:281078 242/709 (34%)
AAA 6. {ECO:0000250} 3397..3620 92/230 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.