DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah7

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_690143.4 Gene:dnah7 ZFINID:ZDB-GENE-070912-282 Length:4005 Species:Danio rerio

Alignment Length:4053 Identity:1278/4054 (32%)
Similarity:2054/4054 (51%) Gaps:489/4054 (12%)


  Fly   779 YLHDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREP-ILSIRAANAADTQRLID 842
            :|.:.|....|:|:::..:|.:                 |..:.||. :|||:       :.::|
Zfish   166 WLKNVLALVPEHLKSLTRTIEA-----------------LSDEMREDYLLSIK-------KNIVD 206

  Fly   843 LLMY---VNLKLFFDIPRRYSLPPGEHGEEDE-----------------------------ESDG 875
            .::.   .|.:|     :...|||  |.:|.|                             |..|
Zfish   207 FVLQDPRENKEL-----KARDLPP--HRQEMEIIPKPWKKSFLQAQKRMRNNLFTVNHTMLEVLG 264

  Fly   876 IWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFR 940
            :|          .|.|||.|.:     |:|.|..|:...|..:.                     
Zfish   265 LW----------QVSFKKLRLI-----DVEAFHSEEESMELSVF--------------------- 293

  Fly   941 EYEIYVDEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKT-- 1003
                       :.||:..|..:|.:.:        ||.|.|:.......|.   |||..|:.:  
Zfish   294 -----------QQLVNKHIERATGILL--------NTWIPEVQKIYHRGNK---RNLIPSNSSVA 336

  Fly  1004 ---GFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYS-------------FYDELQDKSELD 1052
               .|...:.|::  .:.:.||.....||.|.:...||:|             ..|:...|.|.|
Zfish   337 RLQSFYNCVATLM--TSQLQSLALESMQDYTHLIAQNPHSVRVYEHPGFVLRLVLDQNTIKFEPD 399

  Fly  1053 KQ--RVEIMNKIKLALQAV----RVHGKGFMEFSSLWIWD--------KSTYLSEVKKFGRNLTL 1103
            .:  .|.::|.....|:::    ||..|.:.|      |.        |...|.|:      |..
Zfish   400 FKDFEVTVLNVYNAMLKSLSVIPRVETKLYSE------WPGPETHHTLKPIILPEI------LEA 452

  Fly  1104 DERDAEADLEGSSGVKL----LGLEYPPLSVYKEQLD---------KFIELQDQIRTWETYEDFF 1155
            .:......:...|...|    |..:|.||...:.:.|         .|.||..::..::...|  
Zfish   453 QQEKVRRVIRAESAEPLKHVHLYDKYAPLVSQQAEEDVTQFLLEQHSFQELMMEVIRYQQLAD-- 515

  Fly  1156 VFLRLNMTGFKVAVLSQVGQWISLFKLD-------LINRVKNSLKEL--------QDFVDE---- 1201
               .:..:..||..|       .:|:|.       |:.|.:..|::|        |:|.::    
Zfish   516 ---EIQCSTVKVVRL-------GMFELHSHDLVRALVKRAEGLLQKLVNHMLQGHQEFNNKLCEE 570

  Fly  1202 ----ANIVLK--------IELQ----KDDFEGLVKILSVLNQINEKQCI---------------- 1234
                ||..|:        :||:    |.:.|.::::...|.:.|.:.|.                
Zfish   571 YDTIANKALRSPSNTEELMELRAYVAKVEEEEILQLEMKLQESNNRLCFLVDYVTFSPTDIQLNS 635

  Fly  1235 --------YDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSY 1291
                    ..|:||..::||   ::...:|:|                 .|....::::..|:||
Zfish   636 KTFQRHARMPSIFDQHRQII---KEKTGQFQD-----------------GLKLRCERILEDIKSY 680

  Fly  1292 QVDLIEKRILLCD-NMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLF 1355
            : ..:|:.:...| :..|.|.||..|.               .|.||||.  |:.|.:.:....|
Zfish   681 E-QQVEEFVNFGDLSELNKYLKKAQSL---------------NSKLELVM--EKIRGINQEEEAF 727

  Fly  1356 E---LQGPD--PVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRE 1415
            :   .|.|.  .|:.:|..: |:|    ::.|...||..:.|...|...::.:.::.:...:.|.
Zfish   728 DWPVSQYPQRKTVQDQLLPY-LRL----YETAAEFQSQHHQWVTGPLTAVNPDKVEVDVGNYSRG 787

  Fly  1416 LRGLDKAMRTWEPFIFMEASLKNLMTSLR----AVTELQNPAIRDRHWIELMQTTKVKFSM---D 1473
            |..|:|..:.....:.:..|:|..:.:.:    .|..|.||.:|:||| |.|... |.|.:   :
Zfish   788 LYKLEKTFQDLPKPLQIATSVKAEVEAFKEHIPIVQVLCNPGLRERHW-EAMSAV-VGFPLKPSE 850

  Fly  1474 DSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKAS 1538
            :...:...:.|:|..:....::|.:.:.||..:||.:..:.:.|..|||....:..|...:|.:.
Zfish   851 EDACVAHFLPLHLEAHLSAFESISEGASKEHGLEKAMERMVSEWAGMEFTLLPYRETGTSILSSL 915

  Fly  1539 EELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSE 1603
            :|:...|:||..:.|.|..|.:|..||.|:|.|:::|....:|:..|.:||..|.|||.|| .|.
Zfish   916 DEVQMLLDDHIVKTQTMRGSPFIKPFEAEIRDWEDKLLLLQEIMDEWLKVQGTWLYLEPIF-SSP 979

  Fly  1604 DIRSQLPEDSRRFDYIDKEFKALLAQMNADRNV--VRSTNRSGSKLYEHLEILLKMLLLCEKALN 1666
            ||.:|:||:.|||..:||.::..:.|::.|::|  |.:..:...|: :|...||:::|   |.||
Zfish   980 DIMAQMPEEGRRFTAVDKTWRDTMKQVSLDKHVLAVVAIEKMLDKM-KHSNELLELIL---KGLN 1040

  Fly  1667 DYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNL-----ISGSKNAAGM 1726
            :|||.|||.:|||:|:|:.:||:|||...:|..|..||.|.::.:..:..     |:..:::.| 
Zfish  1041 EYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASVVFTDVLDITHMRSSEG- 1104

  Fly  1727 VAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPAL 1791
               |:.|.:..:......|:||.||..:.:.|..::...:.::...|.:..|..|:..||.|..|
Zfish  1105 ---EVVELLDIISTSKARGQVEKWLLELENGMLRSIHKVIGKACEAYLNDLRINWVRAWPGQTVL 1166

  Fly  1792 VGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVH 1856
            ..:|:.||.:.::|.||..:    ||:.|.::..||:::::.|:.|.|:...|..:..:..:|||
Zfish  1167 CVSQVYWTKDIHEAIAKGPK----ALQAYLEQNNTQIDDIVTLVRGKLSKQNRVTLGALVVLDVH 1227

  Fly  1857 SRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTD 1921
            :|||:.:::.|.|:.:|.|:|.||||:.|..  :.....:.:|...|.|||||||||||||||||
Zfish  1228 ARDVLASLVQKGVDDETNFEWLSQLRYYWIE--NQLHTKMINAGLAYGYEYLGNTPRLVITPLTD 1290

  Fly  1922 RCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQT 1986
            |||.||..:|||.:||||.||||||||||||||.:|:.....|||||:.:||.::|...|||...
Zfish  1291 RCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAIAKQCVVFNCSDGLDYIALGKFFKGLLSA 1355

  Fly  1987 GAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRA 2051
            |||.||||||||.:|||||||.|:..||..|.:..:...|.|..:.|..|..||||||||||||:
Zfish  1356 GAWACFDEFNRIDLEVLSVVAQQILTIQRGISAHAEMLLFEGTELKLNPTCAVFITMNPGYAGRS 1420

  Fly  2052 ELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLR 2116
            |||:|||||:|..||:|||:|||:||:|.:.||..||.|:.|.:..|.||.|.||.|.|||:|:|
Zfish  1421 ELPDNLKALFRTVAMMVPDYALIAEIVLYSCGFVRARPLSVKIVATYRLCSEQLSSQHHYDYGMR 1485

  Fly  2117 AIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPE 2181
            |:||||..||.|:....:..||.:|:|::.|.|:||.:..|:|:|.|:..||||.:.:|:   |:
Zfish  1486 AVKSVLTAAGNLKLKFPEENEDVLLLRSIIDVNLPKFLAHDLPLFEGITSDLFPGIKLPK---PD 1547

  Fly  2182 FEAV---IKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQN-- 2241
            :..:   |:.::..:.||..|.|..||:|:.|:..|||...::|....||:..::.|.....:  
Zfish  1548 YSVLLEAIRENSAKMNLQVTDFFAEKILQIYEMMIVRHGFMLVGEPFGGKTSAYRVLAAALNDIC 1612

  Fly  2242 -----QKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDI 2301
                 ::.:.....:|||::|..:|:|..:|.:.||.||:.::..|..|.......||::.||.:
Zfish  1613 EKNLMEENRVQITVINPKSITMGQLYGQFDPVSHEWSDGILAVSYRAFAISQSPDRKWLIFDGPV 1677

  Fly  2302 DPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWT 2366
            |.:|||::|||:||||.|.|.|.|.|.::.:|.|:||...|..|:||||||.|::|:.|..|||.
Zfish  1678 DAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWR 1742

  Fly  2367 PFIQSWLGT---RTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLT 2428
            |.:.|||.|   ..:|....::..|||:.:|..|.:.|...:.::|.|:.:.::....|:|.|:.
Zfish  1743 PVMLSWLNTVPSTLSSMHKDLITGLFDRMLPACLQLIRKGTKELSPTSNTSLVKSLMNLMDCMMD 1807

  Fly  2429 PQNVPNDCPK-------DWYEIYFVFCIVWGFGSS-----------LFQDQIIDWSNEFSK---W 2472
            .....:...:       .|.|..||||::|..|:|           |.::.::...:|.::   .
Zfish  1808 EFGDESQMKRMDQRDVCSWLEGIFVFCLLWSVGASCTEEGRVKFDGLVREMLVGGLSEETRTRHG 1872

  Fly  2473 FLNEYK------AVKFPLSGTIFSF-YIDHETKKFFPWTNLVPQF-ELDMDLPLQSNLVNTAETT 2529
            .|...:      .|..|..||::.: ::.....::..||..:..| .:..|:.....:|.|..|.
Zfish  1873 ILEHVEPPAKQLTVPLPTEGTLYEYRFLKEGPGRWELWTEELKAFPPIPKDVQFNEIIVPTENTV 1937

  Fly  2530 RLRFFMDTLIEADHPLMLIGPSGSGKTI-LMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEK 2593
            |....|..||....|.:.:||:|:||:: :::..|:.|..|.||...:.|:..||:...|.|:..
Zfish  1938 RYNALMKLLITHQKPTVFVGPTGTGKSVYILDFLLNRLEKDVYSPLLINFSAQTTAAQTQNIIMS 2002

  Fly  2594 PLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKC 2658
            .|:|:....:||...|:|:.||||:|||..:.|....|..|:||::|:.:|||.:..::.::...
Zfish  2003 KLDKRRKGVFGPPLGKKMVVFVDDVNMPARETYGAQPPVELLRQWLDHWNWYDMKDCSMINLVDI 2067

  Fly  2659 NIVACMNPSAGSFT-IDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCE 2722
            .|:..|.|..|... :.||..|||.:..:|......:|.|.:.||..|:.... .|.|....:..
Zfish  2068 QIMCAMGPPGGGRNPVTPRFLRHFNTVTINEFDNKTMFTIFSRILDWHLTIRF-PFPKPFASVTS 2131

  Fly  2723 NMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRV 2787
            .:::..::::.:...:.|||..|.||.|||||.:.:..|:..|..||..:...:.|||:||..||
Zfish  2132 QIISATMSVYQEATKNLLPTPAKSHYLFNLRDFSRVIQGICLSRPETADDLTAIKRLWVHEVLRV 2196

  Fly  2788 YGDKLVDYTDINSFKKIVSDIVR-----------KGIEGVNDDVVY---AQPLIYC--HFAKGLT 2836
            |.|:||...|.......:.::.:           |.::..:|.:|.   .:.|::|  |..|| .
Zfish  2197 YYDRLVHPDDCAWMVGFLQEVSKSHLNEDFHQLFKHLDSNSDGLVTEDDLRSLMFCDFHDPKG-E 2260

  Fly  2837 DIKYMPISGWDRLKSLLDEAQDRYNDYIGA-MNLVLFDDAMSHVCRISRILESSRGYALLIGVGG 2900
            |..|..:...::|:.:::...:.||:...| ||||||..|:.|||||||||:..||:|||:||||
Zfish  2261 DRNYREVGDAEKLRQVVETHLEEYNNISKAPMNLVLFRFAIEHVCRISRILKQPRGHALLVGVGG 2325

  Fly  2901 SGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFL 2965
            ||:|||||||:.::..::||::::|.|.||:.:.::..:..|:....:...||.||:::..|.||
Zfish  2326 SGRQSLTRLAAHMAEAELFQVEISKSYGVSEWRDDLKLIMQKSTSGDTHGVFLFTDTQIKMESFL 2390

  Fly  2966 VLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNREN-----------CWKYFIEKVRS 3019
            ..|::||.:|::..||..||.:.|...:|       ::|.:.:           .:..|:|:.||
Zfish  2391 EDVSNLLNTGEVPNLFAVDEKQEICERMR-------VLDRQRDRDKQTDGSTLALFNMFLERCRS 2448

  Fly  3020 LLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVS 3084
            .|.|||..||:|.|.|.|.|:||||:||.|||||..||:.||::|:.|||.::.:........:|
Zfish  2449 QLHVVLAMSPIGDTFRSRLRRFPALINCCTIDWFQSWPEDALQAVASRFLEDVEMTNTAREGCIS 2513

  Fly  3085 NFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLA 3149
            ...:| |.:..|:|..:|:..:||||.||.|:||||:::..||..|....:..:.|.|.||.||.
Zfish  2514 MCKSF-HTSTIDLSAHFLSELQRYNYVTPTSYLELISMFKHLLQRKRTEVMKLKSRYEVGLQKLE 2577

  Fly  3150 SCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAK 3214
            |...:|..:|..|:..:.:|::..:|.:.:::|:..|:|:|||.......:|....  |:.:.||
Zfish  2578 SAATQVSTMQGELEALQPQLRVATKEVEEMMVVIQHESEEVSKTEKVVRVDEAEAN--EQAMAAK 2640

  Fly  3215 A--KLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLF--------- 3268
            |  ..|:.|...|.|.|.||..||:||.:.::|.:|:..:||..|..|..|:.:|.         
Zfish  2641 AIKDECDADLAVAVPILEAALAALDTLTQQDITLVKAMKNPPAGVKLVMEAICILKGIKPDRIPD 2705

  Fly  3269 -SSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQ-PYILDAEFSPEKILAKS 3331
             |..||..:| .|...:..:|:: |||.:|..|:|.:|....:..:: .||.:.:|.||||...|
Zfish  2706 PSGSGKKVED-YWGPAKKLLGDM-KFLQSLHEYNKDNIPVSYMSIIRNKYITNPDFVPEKIRTAS 2768

  Fly  3332 SAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEY 3396
            :||.|||.||..::.:..|..||.||:..|..:|:::|.|.:.|......|.|::::|..||...
Zfish  2769 AAAEGLCKWVCAMDSYDKVAKVVAPKKEKLAHAEEKLKVAMESLRKKQAALKEVQDKLAKLQETL 2833

  Fly  3397 DEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISY 3461
            :....||...:::....:..::.|.:|||||..||.||.|:...|......|.|||||.:..::|
Zfish  2834 ETNKNKKADLENQVEMCSKKLERAEQLIGGLGGEKSRWSETAFNLGQLYNNLTGDILISAAIVAY 2898

  Fly  3462 VGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAA 3526
            :|.||.::||...|: |:...|:.  .||.:..:.....:.:..:|..|...|||||..|.:||.
Zfish  2899 LGAFTSSFRQRATEE-WIDMCKSR--GIPCSKNMSLMNSLGEPVKIRSWTIAGLPSDSFSIDNAI 2960

  Fly  3527 ILVQSERYPLMIDPQLQGIKWVKT-KYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENID 3590
            |:..:.|:|||||||.|..||:|. :....|.|::||..:::..:|..:..|:.:|:||:||.:|
Zfish  2961 IISNARRWPLMIDPQGQANKWLKNMEKSNSLHVIKLSDADFVRTLENCIQFGTPVLLENVGEELD 3025

  Fly  3591 PVLNPLLGRQLIKKG--TVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDG 3653
            |:|.|||.:|..|:|  ..:::||..|::...||..:.|||.||||.||:..:.||:||.:|.:|
Zfish  3026 PILEPLLLKQTFKQGGSVCIRLGDSTIEYAPDFRFYITTKLRNPHYLPEVSVKVTLLNFMITPEG 3090

  Fly  3654 LEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEK 3718
            ::||||..||..||||||..:..|..|....|..|:.:||.:|..||::..|:|||.|.|..|..
Zfish  3091 MQDQLLGIVVARERPDLEEEKQALIVQGAENKRQLQEIEDKILEVLSASEGNILEDETAVQILSS 3155

  Fly  3719 TKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFN 3783
            :|..|:||..|.|.|::|.::||..|..|.|.|..::|::|.:.||..|.|:||:||..|..:|.
Zfish  3156 SKVLANEISEKQAIAEVTELKIDQTRLGYTPIAIHSAILFFSIADLANIEPMYQYSLTWFINLFI 3220

  Fly  3784 NAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDF 3848
            .::..:..::.|::|::.|.|..|:..:....|.|||:|||:|...|.:.:|.:...|:..|..|
Zfish  3221 MSIDNSQKSDLLEERLQILKDHFTYSLYCNVCRSLFEKDKLLFSFCLTVNLLKHNKLVDEKEWRF 3285

  Fly  3849 LLRFPY-MPNQTSN-FTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFP 3911
            ||.... :.|..|| .|||....|..|..|:....||||.||:....:.||:..||:.|.:..||
Zfish  3286 LLTGGVGLDNPHSNPCTWLPKTSWDEICRLDEMERFKGLRKDLARLREGWKEVYDSKDPHHTDFP 3350

  Fly  3912 GEWKGK-SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVL 3975
            .||:.| ...||:.|:||:|||::...::.|:...||.::|:......:..|.:|.....:.|:|
Zfish  3351 SEWQEKLGQFQRMLIIRCLRPDKVVPMVQEFVSGNLGQQFIEVPPFNLATAFADSHCCAPLIFIL 3415

  Fly  3976 SPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWL 4040
            |||.||:..:.|.|:..||:  .....|:||||||..:|.:.||...:.|.||:|||.||...|:
Zfish  3416 SPGSDPMAALLKFGEEQGFT--GNRLTSLSLGQGQGPIAMSMIETGVKEGTWVVLQNCHLATSWM 3478

  Fly  4041 PSLEKKMES-SLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKA--L 4102
            .:||:..|. :....|..:||:|::.|:.:     .|..:|::.:|:|||.|.|:.:||.::  :
Zfish  3479 STLERVCEELNADTTHPDFRLWLTSYPSPN-----FPVAVLQNGVKMTNEAPKGLRSNIIRSFCM 3538

  Fly  4103 DNFSD-ETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYL 4166
            |..|| |..:..||...||.:|||||:|||:..|||||||.|||..|.||..||.|||..|:.:|
Zfish  3539 DPISDPEFFDSSSKPAVFKKLLFSLCFFHALTQERRKFGPLGWNIPYEFNETDLRISVQQLHMFL 3603

  Fly  4167 EANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELI-DGELEYCQGFPAPGILKY 4230
            :....:|::.|||:.||..|||.:|||||||..||.|..|...|:| |.:.::     .|..|.|
Zfish  3604 DQYEEIPFDALRYMTGECNYGGRVTDDWDRRTLRTILSIFYTSEIINDADYKF-----DPSGLYY 3663

  Fly  4231 T----GYHNYID--DNLP-SESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETV 4288
            :    .|::||:  ..|| :.||.::|:::||:|......::.||..:...|.|    ||||...
Zfish  3664 SPPEGDYNSYIEYTKTLPLNPSPEIFGMNANADITKDQVETQLLFDSILLTQSR----SSGGSAA 3724

  Fly  4289 SQEDIIKNIIEDILDKTPTPFNILELMGR--VEDRSPYIIVAFQECERMNNLMTELKRSLNELDL 4351
            |.:|::..:..|||:|.|..|:....|.:  .........|..||..|.|.|:..::.|...:..
Zfish  3725 SSDDMVFEVAADILNKLPQDFDTDAAMRKYPTSYNQSMNTVLVQEMGRFNKLLQTIRDSCVNIQK 3789

  Fly  4352 GLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSS 4416
            .:||.:.:|:.:|:::..:...::|..|.|.:|||:..|..:.||.:.||:.|:.|..| .||:.
Zfish  3790 AIKGLVVMSAELEEVVSSILKGRIPAMWMKKSYPSLKPLGGYISDFLERLKFLQDWYMD-GMPAV 3853

  Fly  4417 IWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARW 4481
            .|::|||..|:.||...|..||:...|:|.:..:.:|.:  .:|....|.:|.||.|||::||||
Zfish  3854 FWMSGFFFTQAFLTGGQQNYARRYTIPIDLLSFDFEVME--DKEYKNPPEDGVYIRGLFLDGARW 3916

  Fly  4482 DMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDI--KNVYECPVYKIRLRGPT---------FVW 4535
            |.:...:|::|.|.|...|||:::|.:  .||||  :..|..||||...|..|         :|.
Zfish  3917 DRRTKRLAESFPKILHDTMPVIWLKPM--KKQDIPERQCYISPVYKTSERRGTLSTTGHSTNYVI 3979

  Fly  4536 TFNLKSRERASKWTLAGVCLLLQ 4558
            :..|.|......|...||.||.|
Zfish  3980 SMALNSDVPPEHWIRRGVALLCQ 4002

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571
DHC_N2 1368..1770 CDD:285579 116/416 (28%)
P-loop_NTPase 1903..2132 CDD:304359 140/229 (61%)
P-loop_NTPase 2217..2352 CDD:304359 48/142 (34%)
P-loop_NTPase 2510..2783 CDD:304359 83/276 (30%)
P-loop_NTPase 2860..3127 CDD:304359 114/279 (41%)
MT 3140..3480 CDD:289543 113/353 (32%)
AAA_9 3509..3722 CDD:289547 91/216 (42%)
Dynein_heavy 3864..4549 CDD:281078 249/711 (35%)
dnah7XP_690143.4 DHC_N2 740..1144 CDD:285579 118/420 (28%)
P-loop_NTPase 1272..1502 CDD:304359 140/230 (61%)
P-loop_NTPase 1586..1729 CDD:304359 49/143 (34%)
P-loop_NTPase 1923..2192 CDD:304359 82/270 (30%)
P-loop_NTPase 2284..2555 CDD:304359 114/279 (41%)
MT 2568..2915 CDD:289543 113/352 (32%)
AAA_9 2944..3159 CDD:289547 91/215 (42%)
Dynein_heavy 3299..3993 CDD:281078 251/715 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.