DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah10

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_062409.1 Gene:Dnah10 MGIID:1860299 Length:4591 Species:Mus musculus

Alignment Length:4812 Identity:1471/4813 (31%)
Similarity:2416/4813 (50%) Gaps:592/4813 (12%)


  Fly     3 DEKEKKEPVDNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGGQ 67
            |..:::..|:...:.:...:.|.:..||:....:.:..|      |||    ::.::|.:.|...
Mouse   116 DMDDEEPDVETYSKLYGKKIVKRIINKLELRVNLASLPE------EFL----QQNVVFFLRSSKD 170

  Fly    68 LYPSYS--------FPVRPRYKVAYFIRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVF 124
            ..|..:        .|....|.|                 :||.:: .||.:      ::| :||
Mouse   171 AIPEATDMKEAMEIMPETMEYGV-----------------INSQVL-QLLKD------VIC-QVF 210

  Fly   125 FPLL--NNTVNQVGW------------------------------TNVIANDMKTESQEMRNGIA 157
            .|.|  |...::.|.                              ..:|.::.....|:..|.  
Mouse   211 MPALSFNQHKSESGQGTLSGENQEFSVYDLAESVVIPGEPMEYHSVQLIRDEFLMNLQKFENN-- 273

  Fly   158 QMKGLVINRTIFPLPICMDEVMQAAPAIAM-GDIS--VVNPLMKHSLEFMVVKWLDSVEDLVNIK 219
                  |.|||..|.   .|:....|:|:: ||:|  |.||.:..:||..|:.||..:...::.:
Mouse   274 ------IQRTIQQLE---GEIKLEMPSISVEGDMSELVSNPELVENLEQCVIHWLGQISYALDSQ 329

  Fly   220 AGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELV 284
            ..:|  .:.|.||.|  ..||..|...|..|.||.....::.:..|:::.:|:...:.:.|:..:
Mouse   330 MKKK--PQGNGPLAE--IEFWRERNATLSALYEQTKLPFVRKVLEVIKEAESMLTANVQPILTEL 390

  Fly   285 LESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLMLT-IGLVWGHSRYFHTLNNMTLFFN 348
            .:...||.|..:.||.::|...............|..|.|:: :.:||..||:::....|.....
Mouse   391 FKLHMEASDNVRFLSTVERHFKNITHGSSFHVVLDTIPSMMSALRMVWIISRHYNRDERMIPLME 455

  Fly   349 LFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINMQHLEYYKLIYNECRNSLK---------KFK 404
            .....:.:.|.|.:...::|:.:...|..|.              .|.||:||         :.|
Mouse   456 RIAWEIAERVCRVINLRTLFKENRANAQFKT--------------QEARNTLKLWKKSYFDIRAK 506

  Fly   405 IGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKL----EKIVMGGLKGRQITFAL 465
            |..:.....|.:.:..:|.|.|......::|.|:...:.:|..:    .|.|.|..|      .:
Mouse   507 IEASGREARWEFDRKRLFERTDYMANICQDLSDVLQVLEEFYNIFGPELKAVTGDPK------RI 565

  Fly   466 EKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRL-SFKAKTDVMERMV------SFQFEKGLE 523
            :.:|...:|:.....::.::|.  ...:|.:.:..: .||.:..|:|:..      ||:..:..|
Mouse   566 DDVLGRVDSLVAPMESLSFDPF--SIRSSPYWKYVMEDFKLEVLVIEKEAKNFIDESFKTLRSAE 628

  Fly   524 DTHDLLLA-GSLLLRPIIKKHVEPLMHVIVDDFEEEIMCVKKEFIN-------FKNVFTALGLNE 580
            ...|:||. ..:..|..|.:.:....:.|:..:.:||..|.|.|:.       :||         
Mouse   629 AAFDMLLKFKHIRSREAINRQMMMKFNDILAQYYKEIDIVNKIFVQNQDNPPLYKN--------- 684

  Fly   581 LPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEY----PLFDNERGGYVSDIFNIMVQEIDDF 641
                  .|.|:|||.:.:.|.:||     :|.:..:    .|.|:|||..|...:..:.:::.::
Mouse   685 ------HPPVAGAICWERSLFYRI-----KHTILRFMEVEELLDSERGQQVKQRYLEVGRKMKEY 738

  Fly   642 TKMLLDKWTVECWQGIQQDITLTLIEK-----------DEANELRVNFTERLIFALKDIKVVRLL 695
            .....:.|.....|.:...:..:|:.|           |......:||:..|...:.:.|.:..|
Mouse   739 EDGKYEHWKETTEQSLPTLMKKSLLTKNIITAEDSAIIDRGTTFIINFSPVLKEIINETKYLEQL 803

  Fly   696 GCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDF- 759
            |..:.........:||       |.:|..|......:..|.....|..||..|:::..:.||.. 
Mouse   804 GFTIPELARNVALQED-------KFLRYTEGIQRMLDHYHLLINTLNEAETALLDDHSQELLRVF 861

  Fly   760 ------IKWNAFSQRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLL 818
                  :.||:                    :...:.:...|::|   ||   |:       .|:
Mouse   862 RSGYKRLNWNS--------------------LGISDYITRCKQAI---GK---FE-------TLV 893

  Fly   819 HTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISL 883
            |...:         ||.|....:.|:..|:|   |..|            ..:.:||: |.:   
Mouse   894 HQIHK---------NADDINSRLTLIESVSL---FRFP------------VAKTADGV-PGV--- 930

  Fly   884 SVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKG--LSQEE----------- 935
                             ::..|..|.|::...:.::    |:.:..|  |::.|           
Mouse   931 -----------------KEFFEYIERERARDVDHMV----RWYMAIGPLLTKVEGLVVHTNTGRA 974

  Fly   936 --RALFREY---EIY--VDEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFEIFMELQEPNVVY 993
              .|.:.||   :||  :.::|.:||   ...:|..||         |.|:|:....|..|.:|.
Mouse   975 PKLASYYEYWEGKIYDVLVKLIQKNL---QAFNSLILR---------NVPLFQAETILSAPEIVL 1027

  Fly   994 FRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTN-----MNP--------------- 1038
            ..|                   .|.:..:.....:...|||.     ||.               
Mouse  1028 HPN-------------------ANEIDKMCVHCVRSCVEVTKHFVRWMNGSCIECPPQKGEEEEV 1073

  Fly  1039 --YSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNL 1101
              .|||:::...:::..|.:.|...|...|..:..:.:.:..:..||..|||..:   :||    
Mouse  1074 VIISFYNDISQNTQIMDQALMIPQNIHRLLVNIMKYLQRWKRYRPLWKLDKSIVM---EKF---- 1131

  Fly  1102 TLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFK 1166
                                ..:.|....|.|:|..:.::...:......:|... :||.:....
Mouse  1132 --------------------AAKKPACVAYDEKLQFYSKIATDVMRHPLIKDEHC-IRLQLEPLA 1175

  Fly  1167 VAVLSQVGQW-ISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINE 1230
            ..|......| |||.|| |....:..|..|:|.::  ::...::......|.|..:|:.:::|..
Mouse  1176 STVQENAKSWVISLGKL-LNESAREELYSLRDEIE--HLAKNLKKSPSTLEDLKFVLATISEIRS 1237

  Fly  1231 KQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDL 1295
            |..:.:..:..::|....:..|.....|||...:|.:.:.|..:...:...:..:..|:....::
Mouse  1238 KSLVMELRYKDIQERYRTMAIYKIFPTDTEQELVNNIENMWESLFTESMNVEHALGGIKRTFTEI 1302

  Fly  1296 IEKRILLCDNMANTYRKKFLSKKFFFVPCL------SCYELIDESDLELVALEERQRSLAESAVL 1354
            ....|:...:..:.:.::|.|:.    |..      ...||:...:.||...|:.::.||.:..|
Mouse  1303 TRSEIMNYRSQLDEFARRFYSQG----PGAVGEDLDKGSELLGSFEKELAKHEKNRQELANAEKL 1363

  Fly  1355 FEL---QGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGREL 1416
            |:|   ..|:.:|::.   ::..::::::...:::....:|.:|.|..::::.:.:..:.|.:.|
Mouse  1364 FDLPITMYPELIKVQK---EMTGLRMIYELYNSLKLAKEEWSQTLWINLNVQYLQEGIEGFLKNL 1425

  Fly  1417 RGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDL 1481
            |.|.:.:|.......:|..:|....|:..:.:|::.|:|:|||.|||:.|.|.|.|.::.||:::
Mouse  1426 RKLPRQVRGLSVAFHLEVKMKAFKDSIPLLLDLKHEALRERHWKELMEKTGVFFEMTETFTLENM 1490

  Fly  1482 IDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEE------ 1540
            ..:.||::.|.:..||..:|||:|:||.:::|...|..|:|       |.:|..|.::|      
Mouse  1491 FAMELHKHTEVLNEIVTAAVKEVAIEKAVKEILDTWENMKF-------TVVKYYKGTQERGYILG 1548

  Fly  1541 ----LIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIG 1601
                :|:.|:|:...||:::.|:::..|...|..|:..||...::|..|..|||||.||||||||
Mouse  1549 SVDDIIQCLDDNTVNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIG 1613

  Fly  1602 SEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALN 1666
            . ||||||||::::||.||:.||.::.:...| .|::....:.::|:: |:.:.:.|..|:|:||
Mouse  1614 G-DIRSQLPEEAKKFDNIDRIFKRIMGETLKD-PVIKRCCEAPNRLHD-LQTISEGLEKCQKSLN 1675

  Fly  1667 DYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNL---ISGSKNAAGMVA 1728
            |||::||.::|||:|:|..:||.||.| ::|..|..|:.|:||::..|..   .||.|..:.|::
Mouse  1676 DYLDSKRNAFPRFFFISDDELLSILGN-SDPLCVQEHMIKMYDNIAMLRFHDGDSGEKLVSAMIS 1739

  Fly  1729 KELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFY-DHKPRHVWIFEWPAQPALV 1792
            .| .|.:.|.:.....|:||.|:..:..:||.|.|...|.::..| :.:.|..|:..:.....|.
Mouse  1740 AE-GEVMTFRKIIRADGRVEDWMTAVLHEMRRTNRLITKEAIFRYCEDRSRVDWMLLYQGMVVLA 1803

  Fly  1793 GTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHS 1857
            .:|:.||.|..|.|.||:|..:.|:|:|.||..:|:::|:..:..:|:..:|:|..|:..||||:
Mouse  1804 ASQVWWTWEVEDVFNKVKQGDKQAMKNYGKKMHSQIDDLVTRITMELSKNDRKKYNTVLIIDVHA 1868

  Fly  1858 RDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDR 1922
            ||:|.:.|...:.....|:|:||||..||.:.|:.....|...|.|.|||:|...||||||||||
Mouse  1869 RDIVDSFIRGSILEAREFEWESQLRFYWDREPDELNIRQCTGTFSYGYEYMGLNGRLVITPLTDR 1933

  Fly  1923 CYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTG 1987
            .|:||||:|.:.:|||||||||||||||||||.:|||::..|.||.|.||||::|.|..||||.|
Mouse  1934 IYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKIFSGLAQCG 1998

  Fly  1988 AWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAE 2052
            |||||||||||...||||::.|::.|::|:..:..||.|.|:.|:|.:.:|:|||||||||||.|
Mouse  1999 AWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQFEGQEISLDSRMGIFITMNPGYAGRTE 2063

  Fly  2053 LPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRA 2117
            |||::|||:||..::|||...|.||||.:|||..|:.||:|...||.|.:|.||||.|||:||||
Mouse  2064 LPESVKALFRPVVVIVPDLQQICEIMLFSEGFLGAKTLAKKMTVLYKLAREQLSKQHHYDFGLRA 2128

  Fly  2118 IKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEF 2182
            :|||||:||.|:|......||.||||||||.|:||.|.:|||:|:|||.||||.||.||.|.|:|
Mouse  2129 LKSVLVMAGELKRGSADLQEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDF 2193

  Fly  2183 EAVIKRSALDLKLQPEDGFIL------KIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQN 2241
            ...::      ::..|:|::|      |:||:.|....||:..::|..|.|||.|..||.:....
Mouse  2194 NDAVE------QVLEENGYVLLPVQVDKVVQMFETMLTRHTTMVVGPTGGGKSVVINTLCQAQTK 2252

  Fly  2242 QKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRD-QANLGGTGPKWIVLDGDIDPMW 2305
            .........||||||:..||:||::|:||:|.||:.|.:.|: .........|:|:.|||:|.:|
Mouse  2253 LGIMTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINRPTDKKERKYILFDGDVDALW 2317

  Fly  2306 IESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQ 2370
            :|::|:||||||:||||:.|||.|.....||||:..|:.|:||||||.|::|::|::|.:.|:.:
Mouse  2318 VENMNSVMDDNKLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYQPYWK 2382

  Fly  2371 SWLGTRTNSSEVSMLNVLFDKYVPPLLDIF---------RTRLRSITPISDIARLQMTCYLLDSM 2426
            .||....|..|...||.||:||||.|:|:.         ..:|:.:.|.:|:..:.....:|||:
Mouse  2383 KWLQQIQNKVEQKYLNDLFEKYVPTLIDMIIEGIVDGRQGEKLKMVVPQTDLNMVTQLTRMLDSL 2447

  Fly  2427 LTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWS------------NEFSKWFLNEYKA 2479
            |  :....|.  |..|.:|:..:....||||.::..:.:.            :....|      |
Mouse  2448 L--EGEIEDL--DLLECFFLEALYCSLGSSLLEEGRVKFDECIKRLSSMPTVDSEGNW------A 2502

  Fly  2480 VKFPLSG---TIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEA 2541
            ....|.|   :::.|:.|.:...:.||..|||::....:......||:|.:|||..:.::.:::.
Mouse  2503 RPGELPGHLPSLYDFHFDAKRNHWIPWNKLVPEYVHSHEKKFVDILVHTVDTTRTTWILEQMVKI 2567

  Fly  2542 DHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPI 2606
            .||::.:|.||:.||......|..|..:...|..|.|:..|||..:||.||..:||:....|||.
Mouse  2568 KHPVLFVGESGTSKTATTQNFLKNLNEETNIVLIVNFSSRTTSLDIQRNLEANVEKRTKDTYGPP 2632

  Fly  2607 GNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQK-MTLRDIHKCNIVACMNPSAGS 2670
            ..||::.|:||||||:||:|.|.||..|::..::..:.|||.| :..:.|.....:|.|..:.|.
Mouse  2633 MGKRLLVFMDDMNMPKVDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGG 2697

  Fly  2671 FT-IDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLK 2734
            .. :|||....|..|.|..||:::|..|..|||..|...    |::::..:...:....:||:..
Mouse  2698 RNEVDPRFLSLFSVFNVPFPSEESLNLIYYSILKGHTST----FNESIGGVSRKLTFCTLTLYKN 2758

  Fly  2735 VVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDIN 2799
            :|....||..||||.|||||::.:|.|::.:|.:.....:||:|:|.:||.||:.|:|::..|..
Mouse  2759 IVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPDRFQTVSQMVRVWRNECLRVFHDRLINEVDKE 2823

  Fly  2800 SFKKIVSDIVRKGIEGVNDD--VVYAQPLIYCHFAKGLTDIK---YMPISGWDRLKSLLDEAQDR 2859
            ..:..:.::|   .|..|||  :|...|:::..|...|.:.:   |..|..::..|:|.:|..:.
Mouse  2824 LVQNHIGNLV---TEHFNDDFEMVMRDPILFGDFRLALQEGEPRIYEDIQDYEAAKALFEEILEE 2885

  Fly  2860 YNDYIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLT 2924
            ||:....|||||||||:.|:.|:.||:...||:|||:||||||||||.|||:|.:..:||:|.|:
Mouse  2886 YNEVNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLARLAAFTAGCEVFEILLS 2950

  Fly  2925 KDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENI 2989
            :.||.::.:.::..||||.|::.....||.||:.||.|.||.|:|::|.||.:..||.::|.:||
Mouse  2951 RGYSENNFRDDLKNLYMKLGLENKMMIFLFTDAHVAEEGFLELINNMLTSGMVPALFAEEEKDNI 3015

  Fly  2990 VNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFH 3054
            :..:..|..:.|:...:|:.|::|:.|..:.|.:||..||||.|||.|.|.||.|||.|.||||.
Mouse  3016 LGQIGQEALKFGMGPAKESVWQFFVNKSANNLHIVLGMSPVGDTLRTRCRNFPGLVNNTGIDWFM 3080

  Fly  3055 EWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLEL 3119
            .||.|||.:|:..||.:.:::|.|....:...:..||::|.:.||.:....:|.||.|||::|:.
Mouse  3081 PWPPQALHAVAKSFLGDNSMIPDEKLEELVEHVVMVHQSVGEFSKQFQQKLRRSNYVTPKNYLDF 3145

  Fly  3120 IALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVG 3184
            |..|||||.||.:.|:.:..|||.||.||...|.::|.|...|..|::.|..|:...:.|:..:.
Mouse  3146 INTYSKLLDEKTQYNIAQCKRLEGGLDKLKEATIQLDELNLKLAEQKIVLAEKSAACEALLEEIA 3210

  Fly  3185 T------ENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNN 3243
            |      |.:|:::|:|...:|:..:..:|: ..|:..|.|     ..|.|.||:..|..|:|::
Mouse  3211 TNTAIAEEKKKLAEEKAIEIEEQNKIIAVEK-AEAETALAE-----VMPILEAAKLELQKLDKSD 3269

  Fly  3244 LTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPD 3308
            :||::||..||..|.:||..:|::   ||.  |:.:||..:..|.: ..||.:|:..|...|...
Mouse  3270 VTEIRSFAKPPKQVQTVCECILIM---KGY--KELNWKTAKGMMSD-PNFLRSLMEIDFDSITQG 3328

  Fly  3309 VIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARD 3373
            .:|.::..:.....:.|::.|.|.|..|:..:|..:..:.||:..::||...:...|:.....:.
Mouse  3329 QVKNIKGLLKTLNTTIEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFFLTKR 3393

  Fly  3374 KLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESV 3438
            :|..:...|..::::|.||..:|:.|:.:|||.|:||......:..|::||.||.:|.:||:..:
Mouse  3394 ELERIQNELAAIQKELEALGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENVRWLNDL 3458

  Fly  3439 KVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPF---EM 3500
            ..|.....:|.||.|:.:.|:||.|.||..:|.|:..::|.....:...|:.     .||   .:
Mouse  3459 DELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNQVWQNDILDRDIPLS-----QPFRLENL 3518

  Fly  3501 ICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTK-YGTGLVVLRLSQR 3564
            :.||.:|:.|.:||||.|.:|.:|..:..::.|:||.||||.|.:.|:|.| ....|.|...:..
Mouse  3519 LTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLRVASFNDP 3583

  Fly  3565 NYLDQVERAVSNGSVLLIENIGENIDPVLNPLL--------GRQLIKKGTVLKIGDREIDFNSRF 3621
            ::|.|:|.::..|:..|..::.|.||||::.:|        |||.|      .:||:|:|::|.|
Mouse  3584 DFLKQLEMSIKYGTPFLFHDVDEYIDPVIDSVLEKNIKTSQGRQFI------ILGDKEVDYDSNF 3642

  Fly  3622 RLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKI 3686
            ||.|:||||||.|.|.:..:..:||:|||..|||||||:.:|..||.:||..|..|.|:.:..|.
Mouse  3643 RLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKN 3707

  Fly  3687 TLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAA 3751
            .||.|||.||..|:::..|:|::|.||..||:||..|.|:..|:..|:.|.:.||..|:.|||||
Mouse  3708 LLKDLEDSLLRELATSTGNMLDNVELVQTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAA 3772

  Fly  3752 ERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSR 3816
            .|.:|::|:|:::..:|.:||:||.||..||..::.|::....|..|::|::|::||..:.|...
Mouse  3773 RRGAILFFVLSEMALVNSMYQYSLIAFLEVFGLSLKKSLPDSILLKRLKNIMDTLTFNIYNYGCT 3837

  Fly  3817 GLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNF----TWLTHVGWGGIRALN 3877
            ||||:.||:|...:.|:|....|.|...||||.|: ..:..:.|.:    |||:..||..|..|:
Mouse  3838 GLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLK-GNISLEKSKWKKPCTWLSDQGWEDIILLS 3901

  Fly  3878 NQ--AVFKGLEKDIEGSHKRWKKFVDSESPENEKFP-GEWKGKSAIQRLCIMRCIRPDRMSYAMR 3939
            .:  .:|..|..|||.....|:::.|.:|.|...|| |.....:|.|:|.|:||.|.||:..|:.
Mouse  3902 QKFSDIFGNLPLDIEHHLPMWQEWYDQDSLEQFPFPLGYDDNITAFQKLLILRCFRVDRVYRAVT 3966

  Fly  3940 SFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSV 4004
            .::...:|.||:....:.|...||:|:|.:.|.|:||||.||..|:.||.:..||......|  :
Mouse  3967 DYVTLTMGEKYVQPPMISFEAIFEQSTPNSPIVFILSPGSDPASDLMKLAERSGFGGTRLKF--L 4029

  Fly  4005 SLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPAGD 4069
            ::|||||.||...:|.|...|.|::|||.||:.:||..|||.:| .::..|..:||:|:.:|...
Mouse  4030 AMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLE-RITKPHPDFRLWLTTDPTKG 4093

  Fly  4070 PAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVA 4134
                 .|.|||:.::|:..|||.|:..|:.......|::.||.| ..|.||.:::.|.:|||||.
Mouse  4094 -----FPIGILQKSLKVVTEPPNGLKLNMRATYFKISNDMLEQC-PHTAFKPLVYVLAFFHAVVQ 4152

  Fly  4135 ERRKFGPQGWNRSYPFNVGDLTISVYVLYNYL-----EANTRVPWEDLRYLFGEIMYGGHITDDW 4194
            ||||||..|||..|.||..|..:.:.:|..||     :.:.|:||..|:||.||:||||...|.:
Mouse  4153 ERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSF 4217

  Fly  4195 DRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNY----IDDNLP------------- 4242
            |||:..||::|::...:.|               .:..:|.:    :|..:|             
Mouse  4218 DRRILTTYMDEYLGDFIFD---------------TFQPFHFFRNKDVDYKIPVGDIKDKFVEAIE 4267

  Fly  4243 ----SESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILD 4303
                :.:|.::|||||||||:.|..:..::..:.||||: ||.||.|  ||::|.|..:.:||.:
Mouse  4268 ALPLANTPEVFGLHSNAEIGYYTQAARDMWGHLLELQPQ-TGESSSG--VSRDDYIGQVAKDIEN 4329

  Fly  4304 KTPTPFNILELMGRVE-DRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLM 4367
            |.|..|::.::...:. ..:|..:|..||..|.|.|:..:.|||.||...|.||:.:|:.::|:.
Mouse  4330 KMPKIFDLDQVRKHLGLSITPTSVVLLQELGRFNKLVIRMTRSLAELQRALAGEVGMSNELDDVA 4394

  Fly  4368 VCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAI 4432
            ..|::..:|..|.|||..::..|.:|....:.|..:...||.:.. ||.:||:|...|:|.|||:
Mouse  4395 RSLFLGHIPHIWRKLAPDTLKTLGNWMVYFLRRFSQYTLWVTEGE-PSVMWLSGLHIPESYLTAL 4458

  Fly  4433 MQQTARKNEWPLDRMCLNCDVTK-KWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKEL 4496
            :|.|.|:|.|||||..|...||| :..:|:.....:|.:::||::|||.||::.|.:..:..|.|
Mouse  4459 VQATCRRNGWPLDRSTLFTQVTKFQDADEVNERAGQGCFVSGLYLEGADWDIERGCLVKSKPKVL 4523

  Fly  4497 FPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLR----GPTFVWTFNLKSRERASKWTLAGVCLLL 4557
            ...:|:|.|......:..::|.:..|||...:|    |...|:..:|.:.:..|.|.|.||||.|
Mouse  4524 VVDLPILKIIPTEGHRLKLQNTFRTPVYTTSMRRNAMGIGLVFEADLFTAKHISHWVLQGVCLTL 4588

  Fly  4558 QT 4559
            .:
Mouse  4589 NS 4590

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 120/617 (19%)
DHC_N2 1368..1770 CDD:285579 132/415 (32%)
P-loop_NTPase 1903..2132 CDD:304359 142/229 (62%)
P-loop_NTPase 2217..2352 CDD:304359 60/136 (44%)
P-loop_NTPase 2510..2783 CDD:304359 90/275 (33%)
P-loop_NTPase 2860..3127 CDD:304359 119/267 (45%)
MT 3140..3480 CDD:289543 100/346 (29%)
AAA_9 3509..3722 CDD:289547 91/222 (41%)
Dynein_heavy 3864..4549 CDD:281078 244/720 (34%)
Dnah10NP_062409.1 DHC_N1 306..878 CDD:285571 121/645 (19%)
DHC_N2 1377..1780 CDD:285579 132/418 (32%)
P-loop_NTPase 1914..2142 CDD:304359 142/228 (62%)
P-loop_NTPase 2230..2365 CDD:304359 61/135 (45%)
P-loop_NTPase 2547..2807 CDD:304359 90/264 (34%)
P-loop_NTPase 2886..3153 CDD:304359 119/267 (45%)
MT 3165..3498 CDD:289543 99/345 (29%)
AAA_9 3527..3743 CDD:289547 91/222 (41%)
Dynein_heavy 3884..4580 CDD:281078 245/724 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.