DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah2

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_009301399.1 Gene:dnah2 ZFINID:ZDB-GENE-130530-910 Length:4506 Species:Danio rerio

Alignment Length:4731 Identity:1482/4732 (31%)
Similarity:2403/4732 (51%) Gaps:450/4732 (10%)


  Fly     1 MADEKEKK--------EPVDN-----RPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNN 52
            :|.|:||.        :.||:     |..|       ..||.|...:|...|.|....:.:|:::
Zfish    48 VAAEREKSVSEVTVAVDEVDSYKKRLREAF-------KQRLALSGISKESWTEENEQALDKFISD 105

  Fly    53 PNKKRIIFTINSGGQLYPSYSFPVRPRYKVAYFIRYLTPLHLTDENMLNSLLIGDLLPNPLANLS 117
            .:.:.::...:....||..|:.|.:...:::||||....: :|:|:..:|:..|.:....:..|.
Zfish   106 SSVRLLVVYHDPFTGLYVDYAMPAQVVEQMSYFIRAPDSM-ITEESFRSSVQFGSVRGGAIEGLL 169

  Fly   118 ILCDEVFFP--LLNNTVNQVGWTNVIANDMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQ 180
            .:.:.|..|  .|:.|     |.....|:...|.......:...:..::..|:..:|:   |.:|
Zfish   170 RMMNGVHTPQVTLSTT-----WPETSKNNYSAELHRFLTKLTDSRFKLLGSTVLYIPL---EALQ 226

  Fly   181 AAPAIAMGDISVVNPLMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLE 245
            ..|     :.:|.|..:...||.:|:.|...::.:::.::...|..... ||.|  .|||:||..
Zfish   227 HRP-----EEAVKNKNLVQRLEMVVIHWTRQIKAVLSAQSVSDIGDTLG-PLEE--ISFWKSRCA 283

  Fly   246 NLENLAEQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFET 310
            :|::::.||....::.|..:|:...|.:...:.::.:.:.||..:|:.....||.||...::...
Zfish   284 DLDSISTQLQKPGVRHIQEILQLYTSTYIPPFCKLAKQIQESSLQAQSNVTFLSLLKEPCEELAQ 348

  Fly   311 NDMDENRSDIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEA 375
            ....|....:..::..|.::|.:|.||:|.:.:|.......|.:|....|.:..:.||||....:
Zfish   349 LKPCEIAPKLAHILNLIRVIWVNSSYFNTRDRITALLRKISNEIIRLCCREISLNRIFQGYAVSS 413

  Fly   376 YKKLDINMQHLEYYKLIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFN 440
            .:.|:..:|....:|.:|      |...::....:||.|:..|..||..:|.|:.|.::|.::..
Zfish   414 KQILNDCIQCCLAWKELY------LHTSQLHHKHSSQGWSLDQISIFALVDSFMQRCKDLIEICE 472

  Fly   441 TVRDFQKL---EKIVM---GGLKGRQITFALEKILEEYNSIYREWTNIQYNPID-PDAENSLFQR 498
            ..:.|.:.   |::.:   .|..|.::|..|..|...::...:...::|    | .|..|..:..
Zfish   473 CQQQFARWEDGERVPLPCFAGRLGSEVTQKLLYIEATFDKSLQVLQSVQ----DILDVRNPSWHE 533

  Fly   499 DRLSFKAKTDVMERMV------SFQFEKGLEDTHDLL-----LAGSLLLRPIIKKHVEPLMHVIV 552
            |...|:||...:|.|:      :|:....:|:...||     |:|    |..||:.::.....:.
Zfish   534 DYSRFRAKLKDLEVMMQNLITSTFEMVNCVEEGVQLLDVFQHLSG----REAIKRTIDRKTVDVY 594

  Fly   553 DDFEEE------IMCVKKEFINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRIIG----L 607
            :.|..|      :||.....|..:                .|:.:|.|.:.|.|..|:..    |
Zfish   595 NLFHSELVEINLVMCRTSSLIPVQ----------------MPRYAGQIHWTKALHSRVERSMEVL 643

  Fly   608 HKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKW----TVECWQGIQQDITLTLIEK 668
            .:.|.|......|.....||.     :.|.:|:..:.:...|    :.||...:.|.:.:..  |
Zfish   644 RRAHFLPHVRSADEMHVIYVK-----LCQTLDEKVRRIFTDWSQSLSKECHSSLDQPLMIRC--K 701

  Fly   669 DEANELRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFER 733
            .:...|.:||.:.|:....:|.....|..::...:|:.:.|.:||...|..::.:...||...:.
Zfish   702 GKTGLLDINFNKNLLKLFNEIHYWDRLQFEIPHFVTEVYQRREELHNLRENVLLVVRDYNRIIKD 766

  Fly   734 AHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKYLHDRLVAAQENLEAIKESI 798
            .:..|..|.:..:..::::::|.|..:.|:...                                
Zfish   767 LNADELGLFSERIRFLDKKIQPGLSKLHWSTKG-------------------------------- 799

  Fly   799 RSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVN-LKLFFDIPRRYSLP 862
                          .|:..::                      |..::.| ::|..|..:..:|.
Zfish   800 --------------TPSAFIN----------------------DCRVHANKVQLMVDEYKAANLA 828

  Fly   863 PGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQ-----------SESEE 916
            ..:|.|:             :|.:..|....|....|     .||:|:|           ..:.:
Zfish   829 TSKHCEQ-------------ISELLLVHLDGKTVYRD-----HEFQEDQQTHQHSQMLRLQNAHQ 875

  Fly   917 EIIT-------PFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEV--DNR 972
            :||.       .||    |.|  .|.:..:..|...:|:::.|....::..|...|...:  |.:
Zfish   876 DIIKIMARVYGTFH----LDG--PEVQQHWTSYMEKIDQMLEEAFRVNIKRSLQELSKAINGDGK 934

  Fly   973 YENNTPIFEIFMELQEPNVVYFRNLDTS-SKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNM 1036
            ...| |:|.:.:.|..........:|.| |....|..:.:|...:...:|..||:   |..:|..
Zfish   935 ISPN-PLFRVEVVLTPETARSTAQVDFSPSPQKLAHIVNSISSQLIKTISGFKRL---PDLLTRQ 995

  Fly  1037 NPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNL 1101
            .     .:.:....:.:|..||. ||:.|:.|..|....::: :.|..|||...:.|::|     
Zfish   996 Q-----SQRKPIHSIIEQDEEIC-KIQGAIAAGMVTNASYLQ-TYLKTWDKHREIWEIEK----- 1048

  Fly  1102 TLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFK 1166
                         .|.::......|.::.:...:.::.|:.:.::..||... ..|:.|:.:..|
Zfish  1049 -------------DSFIQRYQRLNPTVTSFDADIARYTEVANNVQKEETLLS-VQFVLLDCSPLK 1099

  Fly  1167 VAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIV---------------LKI--ELQKDD 1214
            .::|....:|.|.|...|.....:.||||..|:.| |.|               ||:  .||.| 
Zfish  1100 FSLLQHCNEWQSKFTQLLSLMASSKLKELHSFLQE-NAVRLSQPPQTLTDLGESLKLLETLQAD- 1162

  Fly  1215 FEGLVKILSVLNQINEKQCI---YDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKR 1276
               |.||.|.:..|:|:..|   |:...||  .:::||...|.|:...:...|    |:.:.:|:
Zfish  1163 ---LNKIESQIPPIHEQYAILTKYEVAVDP--AVLELLEALNAEWVWFQQVVI----DSDIMLKK 1218

  Fly  1277 LAATTKQ-LIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFF--FVPCLSCYELIDESDLEL 1338
            ...|.|. ||...:.:|            ....|:.:.|.|...|  .|...|..:.:.|...:|
Zfish  1219 HKDTMKSGLILSSEEFQ------------KKTQTFLQSFSSNGPFGSSVTPHSALQQVSELRAQL 1271

  Fly  1339 VALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIE 1403
            .||:|.::::.....:|.::.|....|.....|:..::.:|:.|...:....:||......:..|
Zfish  1272 EALKEEEQNICSGLNIFTIEQPASKDILALEKDVDYLQQVWEIARQWEDLWAEWKGGHLASLQTE 1336

  Fly  1404 NMDQECKKFGRELRGLDKAMRT--WEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTT 1466
            .||...:...:.|..|.:|.:.  ||.....::.::.....:..:|:|:|.|:|:|||.::.|  
Zfish  1337 VMDNTAQTMFKTLHKLSRAFKDKHWEIVDSSKSRIEQFKKIIPLITDLRNSALRERHWNQIRQ-- 1399

  Fly  1467 KVKFSMDDST---TLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHD 1528
            :|:.:.|.|:   ||:.::.|.|..:.|.:.:|...:.||:::|:.|..|...|..|......|.
Zfish  1400 EVQQTFDPSSADFTLEKIVALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHK 1464

  Fly  1529 RTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQ 1593
            ......|:.::|:.:.|||:|..|..:.:|:::..||.||..|:..||...::|.....|||:|.
Zfish  1465 DKGHHKLRGTDEVFQALEDNQVTLSVIKASRFVKAFEKEVDHWERCLSLVLEVIEMILTVQRQWM 1529

  Fly  1594 YLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKML 1658
            |||:||: ::|||.||..::..||.:...:|.::.:::.|:|.:|.|:..|  |.|.|..:...|
Zfish  1530 YLENIFL-ADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTHHPG--LLEKLSEMNTKL 1591

  Fly  1659 LLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLI---SGS 1720
            ...:|:|:.||||||..:|||||:|:.|||:||....||..|..||.|.:|::..|.:.   :|:
Zfish  1592 EEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGN 1656

  Fly  1721 KN-AAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKP--RHVWI 1782
            |: |:||.:.: .|:|.|.......|.||.||..:...||.||:|.|:.........|  |..|:
Zfish  1657 KSEASGMFSAD-GEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKMPGKRGKWV 1720

  Fly  1783 FEWPAQPALVGTQIMWTTETNDAFAKVQQRYE-NALKDYNKKQITQLNNLIILLLGDLTAAERQK 1846
            .:||.|..:..:||.|||:...|....::|.: :|||...|||::.||.....:.|:||...|.|
Zfish  1721 RDWPGQMLITASQIQWTTDVTRALMTSKERADKSALKSLKKKQVSMLNQYSEAIRGNLTKILRLK 1785

  Fly  1847 IMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNT 1911
            |:.:.|::||:|||:..:.........||.|..|||..|:..:|||.....:..|||.||||||:
Zfish  1786 IVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNS 1850

  Fly  1912 PRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSI 1976
            .||||||||||||:|||.:|||..||:|.||||||||||.||||::|||.|.|.||||.:|:||:
Zfish  1851 GRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSM 1915

  Fly  1977 GDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFI 2041
            |.::.|||||||||||||||||::|||||||.|:..|..|:.:....|||.|..|.|..:.|:||
Zfish  1916 GRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLNNFSFEGRQINLIWSCGIFI 1980

  Fly  2042 TMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLS 2106
            |||||||||.|||:|||:::||.:|||||..||:||.|.||||...::||:|..|||:|..:.||
Zfish  1981 TMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLS 2045

  Fly  2107 KQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPA 2171
            ||||||:||||:.|:|..||..||......::::|:.:::|.||.|:.:.|:|:|.|:|.|||||
Zfish  2046 KQDHYDFGLRALTSLLRYAGKKRRARPDIVDEEILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPA 2110

  Fly  2172 LDVPR----KRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVW 2232
            ::.|.    |.....||.:::|.    ||.....:.|::||.|....|||..|:|..|:||:..|
Zfish  2111 VETPTIDYGKLKEAVEAELRQSG----LQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTW 2171

  Fly  2233 KTLNKTYQNQKR--KPHYN-----DLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGT 2290
            :||..|.....|  :|.:|     .||||||:..||:|..|.||.||.||:.|.|||........
Zfish  2172 RTLQNTLSTLHRNGEPGFNLIRECPLNPKAVSLGELYGEYNLSTNEWTDGVLSSLMRMACADEKP 2236

  Fly  2291 GPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGI 2355
            ..||||.||.:|.:||||:|:||||||||||.:.|||::.:::.||||:..|..|:||||||.|:
Zfish  2237 DEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGM 2301

  Fly  2356 LYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTC 2420
            :|.:..||||.|::|||:..| ...|..:|..||::|:...|...:|..:.:..|:::..:...|
Zfish  2302 VYSDYSDLGWKPYVQSWMEKR-QKVETDLLWQLFERYIDKTLAFKKTHCKELVAITELNGVASLC 2365

  Fly  2421 YLLDSMLTPQNVPNDCPKDWY----EIYFVFCIVWGFGSSLFQD--QIIDWSNEFSKWFLNEYKA 2479
            .|..|:.|.:|.......:.|    |::|:|.::|...:|:.::  :.||       .||.|.:.
Zfish  2366 RLYQSLATAENGVKPADSENYGRMVELWFIFSLIWSVCASVDEEGRKKID-------TFLREIEG 2423

  Fly  2480 VKFPLSGTIFSFYIDHETKKFFPWTNLVPQ-FELDMDLPLQSNLVNTAETTRLRFFMDTLIEADH 2543
             .||...||:.:|:|.:.|.:..:.:.:|: :....:.|....:|.|.:|.|..:.:..|:...|
Zfish  2424 -SFPNKDTIYEYYVDTKNKTWASFEDKLPKGWRYASNAPFYKIMVPTVDTVRYHYLVKALVSTQH 2487

  Fly  2544 PLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGN 2608
            |::|.||.|:|||.:..:.|.:|.:..::...|..:..|:|..:|.|:|..:||:....|.|:|.
Zfish  2488 PVLLTGPVGTGKTSVAQSVLQSLDNITWATLTVNMSSQTSSNNVQEIIESRVEKRIKGVYVPVGG 2552

  Fly  2609 KRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFT- 2672
            |:|:.|:||:|||.||.:.:..|..|:|.::||..||||||.||:.|....::..|.|..|..| 
Zfish  2553 KKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDYGFWYDRQKQTLKYIKDLFLLGSMGPPGGGRTH 2617

  Fly  2673 IDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVS 2737
            |..|||..|....:..|::..:..|..:::||    .:|:|::.|..:...:....:.|:..:.|
Zfish  2618 ISGRLQSRFNLINMTFPTESQIKRIYGTMISQ----KLQEFEEEVKPIGGILTQATLELYHAITS 2678

  Fly  2738 SFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFK 2802
            .||||..|.||.||||||:.:|.|:|.::.:.......:.|||||||:||:.|:|||:.|:.:|.
Zfish  2679 RFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFV 2743

  Fly  2803 KIVSDIVRKGIEGVNDDVVY------AQPLIYCHFAK------GLTDIKYMPISGWDRLKSLLDE 2855
            .::|:.:..     :.||.:      .||.::..|.:      .|.|.|        .||..::.
Zfish  2744 GVLSEKLAS-----HFDVPFHTICPNKQPPLFGDFLRESQIYEDLLDFK--------ALKVHMEN 2795

  Fly  2856 AQDRYNDYIGA--MNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDV 2918
            ..:.||...|.  |:||||.||:.||.|:.|::...||..||:|:||||:|||||||::|....|
Zfish  2796 QLEDYNLTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTV 2860

  Fly  2919 FQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPD 2983
            ||:::||.|...:.:.:|..||...||:.....||..|:::..|.||..:|::|:||::..|:..
Zfish  2861 FQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKA 2925

  Fly  2984 DEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCT 3048
            ||::.|.:|:.:..::..|::..:..:.|.||:||:.|.:|||.||||...|.|.|::|||||||
Zfish  2926 DELDEIQSALSDSARKDNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCT 2990

  Fly  3049 TIDWFHEWPQQALESVSLRFLSEITVLPKE-LALPVSNFMAFVHKTVNDISKLYLANAKRYNYTT 3112
            |||||.|||:.||..|:.|.|..:::...: :...|::....||::|...|.......||:||.|
Zfish  2991 TIDWFSEWPRDALLEVAERCLDGLSLGSDDGIQTKVASIFVTVHQSVAQFSHRMKVELKRHNYVT 3055

  Fly  3113 PKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKI---KNQ 3174
            |.::|||::.|.|||.||.....::..:|.|||.|:.....:|:|:.  ::::|.:.|:   :.|
Zfish  3056 PTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMS--VELEEAKKKVAEFQKQ 3118

  Fly  3175 EADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTL 3239
            ..:.|:::|..:.|...:::|..:..|| :...|....|.|:..:.|..:|.|||..|.:||.:|
Zfish  3119 CEEYLVVIVQQKREADEQQKAVGAHSEK-IEAEEIKCKAMAENAQRDLDEALPALEEAMKALESL 3182

  Fly  3240 NKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKH 3304
            ||.::||:||:|.||..|.:|..||::|   :|..|   :|...:..:|. ..|:..|:|:||.:
Zfish  3183 NKKDMTEIKSYGRPPALVETVMQAVMIL---RGCEP---TWAEAKRQLGE-GNFIKQLVNFDKDN 3240

  Fly  3305 IHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVK 3369
            |...|:|.:..|....:|.||.|...|.||..||.||..:..:..::.|||||...|..:..::.
Zfish  3241 ISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLA 3305

  Fly  3370 DARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRW 3434
            :.:..|.....:|.|:.|:|:.|:.:|||.||:|::.:.::......:|.|.:|:.|||.|::||
Zfish  3306 EKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRW 3370

  Fly  3435 MESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFE 3499
            .|:|..|...:..|.||.|:.:.|:||:|.|...:|.||...:||...:..:  :|.:.|.....
Zfish  3371 KETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELE--VPCSPGFSFAV 3433

  Fly  3500 MICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKT-KYGTGLVVLRLSQ 3563
            .:.....:.|||.||||||..|.||..|:.:..|:|||:|||.|.:||:|. ::..||.|:.|..
Zfish  3434 FLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQM 3498

  Fly  3564 RNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKG--TVLKIGDREIDFNSRFRLILH 3626
            .::|..:|.||..||.:|::|:.|.:||.|.|:|.:.|.:.|  .:||:||:||:::..||..:.
Zfish  3499 PDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMT 3563

  Fly  3627 TKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFL 3691
            |||:||||.||:.::||::||.|...|||.|||..||:.|||:||..:..|.......|..|:.|
Zfish  3564 TKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQEL 3628

  Fly  3692 EDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASI 3756
            ||::|..|:.|..::|:||.||..|:.:|.||.|:..::..:::|..|||:|||||||.|:||||
Zfish  3629 EDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASI 3693

  Fly  3757 IYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQ 3821
            ::|:||||..|:|:|||||.|:..:|..::..:..:.||::|:.||....|:..:.||.|||||.
Zfish  3694 LFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFEC 3758

  Fly  3822 DKLIFLTQLCIQILVNLGEVEPTELDFLLR-------FPYMPNQTSNFTWLTHVGWGGIRALNNQ 3879
            .||:|...:|.:||...|::...|.:|.||       ...|.|..|:  ||:...|..|..|:..
Zfish  3759 HKLLFSFHMCAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSH--WLSDSNWDNITELDKL 3821

  Fly  3880 AVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGK-SAIQRLCIMRCIRPDRMSYAMRSFIE 3943
            ..|..|....|...:.|..:..:..||....||||:.. :.:|::.|:|.:|.||:|..:.:|:.
Zfish  3822 TNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVI 3886

  Fly  3944 EKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQ 4008
            ..|||::::...::......:|:..|.:.|||||||||...:.:|.::.|..   :.|.::||||
Zfish  3887 NNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPGVDPTAALLQLAETSGMG---QRFFALSLGQ 3948

  Fly  4009 GQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKM-ESSLSNVHTSYRLFLSAEPAGDPAA 4072
            ||..:|...|:.....||||.|.|.||...|:..|:|.: |..:...|..:||:||:.|..:   
Zfish  3949 GQAPIATRLIKEGVANGHWVFLANCHLSLSWMCELDKLVDELQVQECHPDFRLWLSSSPHPE--- 4010

  Fly  4073 HILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERR 4137
              .|..||::.||||.|||.|:..|:.:.....|:.....||:...::.:|||||:||:|:.|||
Zfish  4011 --FPIAILQTGIKITTEPPRGVKWNMKRLYQRVSETQFLRCSRPLLYRKLLFSLCFFHSVILERR 4073

  Fly  4138 KFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTY 4202
            ||...|||..|.||..|..:|..:|..||:....:||:.|::|...|.||||:||||||||..||
Zfish  4074 KFLQLGWNIIYSFNDSDFEVSENLLSLYLDEYEEIPWDALKFLIAGINYGGHVTDDWDRRLLTTY 4138

  Fly  4203 LEEFMQPELIDGELEYCQGFPAPGILKY--------TGYHNYIDDNLPS-ESPSLYGLHSNAEIG 4258
            :.::..|.:||...     |....::.|        :.|.:|| ..||: |.|.|:|.:.||:|.
Zfish  4139 INQYFCPAVIDTPF-----FKVSSLVSYYVPRDGSQSSYVDYI-SQLPALEHPELFGQNPNADIA 4197

  Fly  4259 FLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFN------ILELMGR 4317
            ...|.:..||..:..|||::|...:.....|:||.:..:..|:|.|.|...:      :|:    
Zfish  4198 SQITEARTLFHTLLSLQPQVTSTDTTSAGASREDKVLELSADVLQKIPAEIDYEGTRKLLK---- 4258

  Fly  4318 VEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKL 4382
             :|.||..:|..||.:|.|.|:..::.||.||:.|:||.:.:||.:|:...|::..:||..|.| 
Zfish  4259 -DDLSPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEK- 4321

  Fly  4383 AYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRM 4447
            ||||:..|.||..||..|:.:...|....|.|...||:||..|...|||::|.:||:|...:|.:
Zfish  4322 AYPSLKPLASWTRDLCQRVEQFARWAETARPPVLFWLSGFTFPTGFLTAVLQSSARQNNVSVDTL 4386

  Fly  4448 CLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDK 4512
            .....||......|...|::|..|.|||:|||.||.|...:.:|...:|...||.::.|.|...|
Zfish  4387 SWEFSVTTVEDNNLLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHFKPVESRK 4451

  Fly  4513 QDIKNVYECPVYKIRLRG-----PTFVWTFNLKS-RERASKWTLAGVCLLL 4557
            :..||:|.||.|...:|.     .:||...:||| ......|...|..||:
Zfish  4452 RLAKNMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVPYDHWIKRGTALLM 4502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 124/598 (21%)
DHC_N2 1368..1770 CDD:285579 127/411 (31%)
P-loop_NTPase 1903..2132 CDD:304359 147/229 (64%)
P-loop_NTPase 2217..2352 CDD:304359 69/142 (49%)
P-loop_NTPase 2510..2783 CDD:304359 91/274 (33%)
P-loop_NTPase 2860..3127 CDD:304359 111/270 (41%)
MT 3140..3480 CDD:289543 110/343 (32%)
AAA_9 3509..3722 CDD:289547 95/216 (44%)
Dynein_heavy 3864..4549 CDD:281078 241/708 (34%)
dnah2XP_009301399.1 DHC_N1 237..799 CDD:285571 124/602 (21%)
DHC_N2 1301..1705 CDD:285579 127/410 (31%)
P-loop_NTPase 1842..2072 CDD:304359 147/230 (64%)
P-loop_NTPase 2158..2299 CDD:304359 69/141 (49%)
P-loop_NTPase 2461..2724 CDD:304359 91/267 (34%)
P-loop_NTPase 2809..3070 CDD:304359 108/261 (41%)
MT 3083..3415 CDD:289543 109/342 (32%)
AAA_9 3443..3659 CDD:289547 95/216 (44%)
Dynein_heavy 3801..4494 CDD:281078 243/715 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.