DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and DNAH3

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_016878921.1 Gene:DNAH3 HGNCID:2949 Length:4130 Species:Homo sapiens

Alignment Length:4172 Identity:1288/4173 (31%)
Similarity:2034/4173 (49%) Gaps:546/4173 (13%)


  Fly   805 PLFQRKDLNPALLL-----HTDPREPILSIRAANAADTQRLIDLLMYVNLKLF----FDIPR--- 857
            ||.||.....|...     |..|.:.|.:..:..|.|. :|.||     ||::    ..:||   
Human    84 PLMQRTSWTLAAPFKEQHHHRGPSDSIANNYSLMAQDL-KLKDL-----LKVYQPATISVPRDRT 142

  Fly   858 ---------RYSLPP-------GEHGEEDEESDGIWPPIISLSVMTSVKFKKKREV--------- 897
                     |.|..|       ....:||...       |.|:..||:....|:||         
Human   143 GQGLPSSGNRSSSEPMRKKTKFSSRNKEDSTR-------IKLAFKTSIFSPMKKEVKTSLTFPGS 200

  Fly   898 ------------IDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEII 950
                        :.:|.::|..|::.|||:.|    .:.|.|..|:.::..|. .|.|:.|.   
Human   201 RPMSPEQQLDVMLQQEMEMESKEKKPSESDLE----RYYYYLTNGIRKDMIAP-EEGEVMVR--- 257

  Fly   951 AENLVDSVITSSTYLRMEVDNRYENNTPIFEIFMELQE--------PNVVYFRNLDTSSKTGFAF 1007
            ...|:.:.:.:|.:|.           |:..:.::.:|        .::|.:..:|...:.  ..
Human   258 ISKLISNTLLTSPFLE-----------PLMVVLVQEKENDYYCSLMKSIVDYILMDPMERK--RL 309

  Fly  1008 FIETI-----------------------------LDDMNNMMSLLK-------------RVAQDP 1030
            |||:|                             |..:|.||..||             |.|:..
Human   310 FIESIPRLFPQRVIRAPVPWHSVYRSAKKWNEEHLHTVNPMMLRLKELWFAEFRDLRFVRTAEIL 374

  Fly  1031 TEVTNMNPYSFYDELQDKSELDKQRVEIMNK-IKLALQAVRVHGKGFMEFSSLWIWDKS----TY 1090
            .....:.|..|:|.:| |..|:..:. ::|| |....|......:.::.|:....:|.|    .|
Human   375 AGKLPLQPQEFWDVIQ-KHCLEAHQT-LLNKWIPTCAQLFTSRKEHWIHFAPKSNYDSSRNIEEY 437

  Fly  1091 LSEVKKFGRNLTLDE----------------RDAEADLEGSSGVK-------LLGLEY-PPLSVY 1131
            .:.|..| .:|.|.|                :|.....|....:|       ::.||. .|:.|:
Human   438 FASVASF-MSLQLRELVIKSLEDLVSLFMIHKDGNDFKEPYQEMKFFIPQLIMIKLEVSEPIIVF 501

  Fly  1132 KEQLDKFIELQDQIRTWETYEDFFVFLRLNMTG-------------------------------- 1164
            ....|         ..||...|.|:.:..|..|                                
Human   502 NPSFD---------GCWELIRDSFLEIIKNSNGIPKLKYIPLKFSFTAAAADRQCVKAAEPGEPS 557

  Fly  1165 -----------------------------------FKVAVLSQVG--QWISLFK--LDLINRVKN 1190
                                               |||...:|||  ::::::|  :||::....
Human   558 MHAAATAMAELKGYNLLLGTVNAEEKLVSDFLIQTFKVFQKNQVGPCKYLNVYKKYVDLLDNTAE 622

  Fly  1191 S-----LKE---LQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIID 1247
            .     |||   :.|||.:.|.:.|   ::::...:...:.:.....:...:...:.:..:.:.|
Human   623 QNIAAFLKENHDIDDFVTKINAIKK---RRNEIASMNITVPLAMFCLDATALNHDLCERAQNLKD 684

  Fly  1248 LLRQYNYEF-KDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQV--------------DLIE 1297
            .|.|:..:. :||..:..|:......||..:.|.||:|::.|:..:.              |..|
Human   685 HLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTKELVSLIEFLKKSSAVTVFKLRRQLRDASE 749

  Fly  1298 KRILLCDNMANTYRKKFLSKKFFFVPCL------SCYELI----DESDLELV------------- 1339
            :...|.|.....|....|:...|..|..      :...|:    |:::::|:             
Human   750 RLEFLMDYADLPYEDIKLNSTLFLWPDQIEDIFDNSRNLLLHKRDQAEMDLIKRCSEFELRLEGY 814

  Fly  1340 -----------------------ALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIM--- 1378
                                   .|.|..::|..:...|||...:...:|..:....|::.|   
Human   815 HRELESFRKREVMTTEEMKHNVEKLNELSKNLNRAFAEFELINKEEELLEKEKSTYPLLQAMLKN 879

  Fly  1379 -------WDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASL 1436
                   |..|........:|...|   :.:.|.:|..::.|...|...|.::|          |
Human   880 KVPYEQLWSTAYEFSIKSEEWMNGP---LFLLNAEQIAEEIGNMWRTTYKLIKT----------L 931

  Fly  1437 KNLMTSLRAVTELQ-----------------NPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDL 1484
            .::....|....::                 ||.::||||.::.:....:....::|.|.::::.
Human   932 SDVPAPRRLAENVKIKIDKFKQYIPILSISCNPGMKDRHWQQISEIVGYEIKPTETTCLSNMLEF 996

  Fly  1485 NLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQ 1549
            ...::.|:::.|...:.||.::||.|..:...|..:.|....:..|...:|.|.:::...|:||.
Human   997 GFGKFVEKLEPIGAAASKEYSLEKNLDRMKLDWVNVTFSFVKYRDTDTNILCAIDDIQMLLDDHV 1061

  Fly  1550 GQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSR 1614
            .:.|.|..|.:|...|.|.|.|:.:|......:.:|.:.|..|.|||.|| .||||.:|:||:.|
Human  1062 IKTQTMCGSPFIKPIEAECRKWEEKLIRIQDNLDAWLKCQATWLYLEPIF-SSEDIIAQMPEEGR 1125

  Fly  1615 RFDYIDKEFKALLAQMNADRNVVRSTN--RSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYP 1677
            :|..:|..:|:|::|...|..::.:.:  |...||.| ...||:.:   :|.||||||.|||.:|
Human  1126 KFGIVDSYWKSLMSQAVKDNRILVAADQPRMAEKLQE-ANFLLEDI---QKGLNDYLEKKRLFFP 1186

  Fly  1678 RFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLISGSKNAAGMVAKELEEYVPFLEN-- 1740
            ||:|:|:.:||:|||...:|..|..||.|.::.:.||. .:.:....||::.| :|.|||::.  
Human  1187 RFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLE-FTDNLEIVGMISSE-KETVPFIQKIY 1249

  Fly  1741 -CDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETND 1804
             .:..|.||.||.::...|..::|:.:...:..|...||:.|:.:||.|..:..:.|.||.|.:.
Human  1250 PANAKGMVEKWLQQVEQMMLASMREVIGLGIEAYVKVPRNHWVLQWPGQVVICVSSIFWTQEVSQ 1314

  Fly  1805 AFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKV 1869
            |.|      ||.|.|:.||...|:..::.|:.|.|::..|..:..:..||||:||||..:...:|
Human  1315 ALA------ENTLLDFLKKSNDQIAQIVQLVRGKLSSGARLTLGALTVIDVHARDVVAKLSEDRV 1373

  Fly  1870 EVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLV 1934
            .....|||.||||:.|..|  |....|...:..|.||||||:|||||||||||||.||..:|.|.
Human  1374 SDLNDFQWISQLRYYWVAK--DVQVQIITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLN 1436

  Fly  1935 MGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRIS 1999
            :||||.||||||||||||||.:||.....|||||:.:|||::|...|||||.|||.||||||||.
Human  1437 LGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIE 1501

  Fly  2000 VEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPC 2064
            ||||||||.|:..||.||..|.:||.|.|..::|..|..||||||||||||||||:|||||:|..
Human  1502 VEVLSVVAQQILSIQQAIIRKLKTFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTV 1566

  Fly  2065 AMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALR 2129
            ||:|||:|||.||.|.:.||.::|.||:|.:..|.||.|.||.|.|||:|:||:||||..||.|:
Human  1567 AMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLK 1631

  Fly  2130 RDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEA---VIKRSAL 2191
            ....:..|..:|:|||.|.|:.|.:..|||:|.|:|.||||.:.:|:   |::|.   |:..:..
Human  1632 LKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPK---PDYEVFLKVLNDNIK 1693

  Fly  2192 DLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKT-------LNKTYQNQKRKPHYN 2249
            .:||||...||.||:|:.|:..|||...|:|....||:..:|.       |:...|.::....|.
Human  1694 KMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEYK 1758

  Fly  2250 DLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMD 2314
            .:||||:|..:|:|..:..:.||.||:.:...|:||:......|||:.||.:|.:|||::|||:|
Human  1759 IINPKAITMGQLYGCFDQVSHEWMDGVLANAFREQASSLSDDRKWIIFDGPVDAIWIENMNTVLD 1823

  Fly  2315 DNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNS 2379
            |||.|.|.|.|.|.:..:|.|:||.|.|..|:||||||.|::|:.|..|||.|...|::.|..:|
Human  1824 DNKKLCLMSGEIIQMNSKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLKDSYMDTLPSS 1888

  Fly  2380 ---SEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDI----ARLQMTCYLLDSMLTPQNVPNDCP 2437
               ....::|.:|...|.|.|:..|...:.:...|.|    :.:::...|||.:...:....:..
Human  1889 LTKEHKELVNDMFMWLVQPCLEFGRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIRAVEEEEMELG 1953

  Fly  2438 KD--------WYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLN----------EYKAVK--- 2481
            :.        |.:..|:|.:||....::..|.    ..:|..:|.|          ..|:||   
Human  1954 EGLSSQQIFLWLQGLFLFSLVWTVAGTINADS----RKKFDVFFRNLIMGMDDNHPRPKSVKLTK 2014

  Fly  2482 ---FPLSGTIFSFY-IDHETKKFFPWTNLVPQFE--LDMDLPLQSNLVNTAETTRLRFFMDTLIE 2540
               ||..|:|:.|| |...:..:..||..:.:.|  :.....:...::.|.||.|..||:.|.::
Human  2015 NNIFPERGSIYDFYFIKQASGHWETWTQYITKEEEKVPAGAKVSELIIPTMETARQSFFLKTYLD 2079

  Fly  2541 ADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGP 2605
            .:.|::.:||:|:||:.:.|..|..||.:.|....:.|:..|::...|.|:...|:::....:||
Human  2080 HEIPMLFVGPTGTGKSAITNNFLLHLPKNTYLPNCINFSARTSANQTQDIIMSKLDRRRKGLFGP 2144

  Fly  2606 IGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGS 2670
            ...|:.:.||||:|||..:.|....|..|:||::|:.:|:|::..|..||....:|..|.|..|.
Human  2145 PIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTTRLDIVDMLLVTAMGPPGGG 2209

  Fly  2671 FT-IDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLK 2734
            .. |..|..||....::|....|.|..|.:||:..|..   :.||...::..:.:|....|::..
Human  2210 RNDITGRFTRHLNIISINAFEDDILTKIFSSIVDWHFG---KGFDVMFLRYGKMLVQATKTIYRD 2271

  Fly  2735 VVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSN-----QMIRLWIHECYRVYGDKLVD 2794
            .|.:||||..|.||.|||||.:.:..|||     .||:::     :.|||||||.|||:.|:|:|
Human  2272 AVENFLPTPSKSHYVFNLRDFSRVIQGVL-----LCPHTHLQDVEKCIRLWIHEVYRVFYDRLID 2331

  Fly  2795 YTD----INSFKKIVSDIVRKGIEGVNDDVVYAQP-----------LIYCHFAKGLTDIK-YMPI 2843
            ..|    .|..|:..|:..::.||.|   :::..|           |.:..:.|..:|.| |..|
Human  2332 KEDRQVFFNMVKETTSNCFKQTIEKV---LIHLSPTGKIVDDNIRSLFFGDYFKPESDQKIYDEI 2393

  Fly  2844 SGWDRLKSLLDEAQDRYNDYIGA-MNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLT 2907
            :...:|..:::...:.:|:...| |:||:|..|:.|:.||.|:|:..:|:.||:|:||||:||..
Human  2394 TDLKQLTVVMEHYLEEFNNISKAPMSLVMFRFAIEHISRICRVLKQDKGHLLLVGIGGSGRQSAA 2458

  Fly  2908 RLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLL 2972
            :|::|:::.:::||::||:|:.:|.:.::..:.::.||.|.:..||..|:::..|.|:..:|.||
Human  2459 KLSTFMNAYELYQIEITKNYAGNDWREDLKKIILQVGVATKSTVFLFADNQIKDESFVEDINMLL 2523

  Fly  2973 ASGDIHELFPDDE----VENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGAT 3033
            .:||:..:||.||    ||.:..|.|.:.:::.:..  .:.:.:|||:||..|.:||..||:|..
Human  2524 NTGDVPNIFPADEKADIVEKMQTAARTQGEKVEVTP--LSMYNFFIERVRKNLHIVLAMSPIGDA 2586

  Fly  3034 LRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDIS 3098
            .|.|.|.||:|:||.|||||..||..|||.|:.:||.::. |...:.:.|.:...:..::|..:|
Human  2587 FRNRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVE-LDDNIRVEVVSMCKYFQESVKKLS 2650

  Fly  3099 KLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLK 3163
            ..|....:|:||.||.|:||||..:..||:.|.:.....|.|...||.||.....:|..:|..|.
Human  2651 LDYYNKLRRHNYVTPTSYLELILTFKTLLNSKRQEVAMMRNRYLTGLQKLDFAASQVAVMQRELT 2715

  Fly  3164 VQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPA 3228
            ..:.:|.:.::|...:::.:..|..:...::.....:||...............||.|..:|.||
Human  2716 ALQPQLILTSEETAKMMVKIEAETREADGKKLLVQADEKEANVAAAIAQGIKNECEGDLAEAMPA 2780

  Fly  3229 LIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLF----------SSKGKIPKDRSWKAC 3283
            |.||..||:|||..:::.:||..:||..|..|..::.::.          |..||:.:| .|...
Human  2781 LEAALAALDTLNPADISLVKSMQNPPGPVKLVMESICIMKGMKPERKPDPSGSGKMIED-YWGVS 2844

  Fly  3284 RAFMGNVDKFLDNLINYDKKHIHPDVIKAL-QPYILDAEFSPEKILAKSSAAAGLCSWVININRF 3347
            :..:|:: |||::|..|||.:|.|..:|.: :.:|...||.|..|...|||..|||.||..:..:
Human  2845 KKILGDL-KFLESLKTYDKDNIPPLTMKRIRERFINHPEFQPAVIKNVSSACEGLCKWVRAMEVY 2908

  Fly  3348 YDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASK 3412
            ..|..||.||...|.|:|.::.....||......|..:.::|.||..:::|...||:..::....
Human  2909 DRVAKVVAPKRERLREAEGKLAAQMQKLNQKRAELKLVVDRLQALNDDFEEMNTKKKDLEENIEI 2973

  Fly  3413 TAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKL 3477
            .:..:..|.:||.||..||.||.|:.:.|......|.||:|:.|..::|:|.||..||.:.|.: 
Human  2974 CSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYTNLTGDVLLSSGTVAYLGAFTVDYRVQCQNQ- 3037

  Fly  3478 WMPAFKNSQPPIPSTDGVDPFEM---ICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMID 3539
            |:...|:...|     |...|.:   :.|..:|..|...|||.|..|.:|..|:..|.|:.||||
Human  3038 WLAECKDKVIP-----GFSDFSLSHTLGDPIKIRAWQIAGLPVDSFSIDNGIIVSNSRRWALMID 3097

  Fly  3540 PQLQGIKWVKT-KYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIK 3603
            |..|..||:|. :....|.|::.|..||:..:|.|:..|:.:|||||||.:|..:.|:|.:...|
Human  3098 PHGQANKWIKNMEKANKLAVIKFSDSNYMRMLENALQLGTPVLIENIGEELDASIEPILLKATFK 3162

  Fly  3604 KGTV--LKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVE 3666
            :..|  :::|:..|:::..|:|.:.|:|.||||.||:..:..|:||.:|..||:||||..|...|
Human  3163 QQGVEYMRLGENIIEYSRDFKLYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKE 3227

  Fly  3667 RPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVA 3731
            :|:||..:.:|..:....|..||.:||.:|..||.:..|:|||.|.:..|..:|..::||..|..
Human  3228 KPELEEKKNQLIVESAKNKKHLKEIEDKILEVLSMSKGNILEDETAIKVLSSSKVLSEEISEKQK 3292

  Fly  3732 EAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLK 3796
            .|.:|..|||..|..|:|.|..::.|:|.::||..|.|:||:||..|..::.:::..:..:|:|.
Human  3293 VASMTETQIDETRMGYKPVAVHSATIFFCISDLANIEPMYQYSLTWFINLYMHSLTHSTKSEELN 3357

  Fly  3797 DRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLR------FPYM 3855
            .|::.:||..|...:....|.|||:|||:|...|.|.|:....|:......|||.      .|| 
Human  3358 LRIKYIIDHFTLSIYNNVCRSLFEKDKLLFSLLLTIGIMKQKKEITEEVWYFLLTGGIALDNPY- 3421

  Fly  3856 PNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGKSAI 3920
            ||....  ||:...|..|...:......||.:.:|.:...||...||..|..|:.||.||....:
Human  3422 PNPAPQ--WLSEKAWAEIVRASALPKLHGLMEHLEQNLGEWKLIYDSAWPHEEQLPGSWKFSQGL 3484

  Fly  3921 QRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDV 3985
            :::.|:||:|||:|..|:|.||.|.:|..||:|.:.:...::.:||....:.|||||..||:..:
Human  3485 EKMVILRCLRPDKMVPAVREFIAEHMGKLYIEAPTFDLQGSYNDSSCCAPLIFVLSPSADPMAGL 3549

  Fly  3986 EKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESS 4050
            .|....||..  .....::||||||..:|...|..|.:.|.||:|||.||.|.|:|:|||..|..
Human  3550 LKFADDLGMG--GTRTQTISLGQGQGPIAAKMINNAIKDGTWVVLQNCHLAASWMPTLEKICEEV 3612

  Fly  4051 L--SNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKAL--DNFSDET-L 4110
            :  .:.:..:||:|::.|     :...|..||::.||:|||||.|:.||:.::.  |..||.. .
Human  3613 IVPESTNARFRLWLTSYP-----SEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPVFF 3672

  Fly  4111 EMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWE 4175
            :.|:|...::.:||.||:|||||.|||.|||.|||..|.||..||.||::.:..:|.....||::
Human  3673 QSCAKAVMWQKMLFGLCFFHAVVQERRNFGPLGWNIPYEFNESDLRISMWQIQMFLNDYKEVPFD 3737

  Fly  4176 DLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPG----ILKYTGYHNY 4236
            .|.||.||..|||.:|||.||||..:.|..|...|:   |.:|..  .|||    |..:..|.:|
Human  3738 ALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKEI---EEDYYS--LAPGDTYYIPPHGSYQSY 3797

  Fly  4237 ID--DNLP-SESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNII 4298
            ||  .||| :..|.::|||.||:|......:.:||..|....||.:|||.    .|.:::::.:.
Human  3798 IDYLRNLPITAHPEVFGLHENADITKDNQETNQLFEGVLLTLPRQSGGSG----KSPQEVVEELA 3858

  Fly  4299 EDILDKTPTPFNILELMGR---VEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTIS 4360
            :|||.|.|..|::.|:|..   |.:.|...::. ||..|.|.|...::|||..|...:||::.:|
Human  3859 QDILSKLPRDFDLEEVMKLYPVVYEESMNTVLR-QELIRFNRLTKVVRRSLINLGRAIKGQVLMS 3922

  Fly  4361 SVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNP 4425
            |.:|::...:.:.:||..|...:|||:..|..:.:||:.||...:.|: |...|...|::||:..
Human  3923 SELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWI-DKGPPVVFWISGFYFT 3986

  Fly  4426 QSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIAD 4490
            ||.||.:.|..|||...|:|.:....:||.: :..:...|.:||||.|||:||||||.|...|.:
Human  3987 QSFLTGVSQNYARKYTIPIDHIGFEFEVTPQ-ETVMENNPEDGAYIKGLFLEGARWDRKTMQIGE 4050

  Fly  4491 AFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGPT---------FVWTFNLKSRERAS 4546
            :..|.|:..:|::::|.........:::|.|||||...|..|         :|.:..|.:.....
Human  4051 SLPKILYDPLPIIWLKPGESAMFLHQDIYVCPVYKTSARRGTLSTTGHSTNYVLSIELPTDMPQK 4115

  Fly  4547 KWTLAGVCLLLQ 4558
            .|...||..|.|
Human  4116 HWINRGVASLCQ 4127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571
DHC_N2 1368..1770 CDD:285579 115/434 (26%)
P-loop_NTPase 1903..2132 CDD:304359 148/229 (65%)
P-loop_NTPase 2217..2352 CDD:304359 55/142 (39%)
P-loop_NTPase 2510..2783 CDD:304359 88/281 (31%)
P-loop_NTPase 2860..3127 CDD:304359 99/272 (36%)
MT 3140..3480 CDD:289543 103/351 (29%)
AAA_9 3509..3722 CDD:289547 82/216 (38%)
Dynein_heavy 3864..4549 CDD:281078 250/709 (35%)
DNAH3XP_016878921.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.