DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah9l

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_021333021.1 Gene:dnah9l ZFINID:ZDB-GENE-050506-1 Length:4521 Species:Danio rerio

Alignment Length:4656 Identity:2188/4657 (47%)
Similarity:3015/4657 (65%) Gaps:266/4657 (6%)


  Fly    12 DNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGGQLYPSYSFPV 76
            |.|.:|........:|:|.|||.:.|...|.:..:::||:...::.:|..:..||          
Zfish    20 DERVDFIREQAFAILRVKTDKWNRFIGLEENQRALLDFLDQSWREYLILFMGPGG---------- 74

  Fly    77 RPRYKVAYFIRYLTPLHLTDENMLNSLL----------IGDLLPNPLANLSILCDEVFFPLLNNT 131
                          .||..||.:..|||          :|::...|:....::..:||..:|.:.
Zfish    75 --------------TLHAGDEQVSLSLLHYCSSTSQLWLGEVAAQPMDYAPVIISQVFISVLGSP 125

  Fly   132 VNQVGWTNVIANDMKTESQEMRNGIAQMKGLVINRTIFPLPICM---DEVMQAAPAIAMGDISVV 193
            :||..|..|:..|:....:.:|:....:||....||:..||:|:   ||...::      |..::
Zfish   126 LNQSAWPRVVGQDICRHLEHLRSEAVTLKGRAQGRTLLALPLCVERKDEHQLSS------DTCLI 184

  Fly   194 NPLMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENL----ENLAEQL 254
            :..:.:|:|.||::|...:..::. :...|:..:.:.|.|....:||..:.|||    :.:..||
Zfish   185 DRALLYSIETMVIQWCRLMGSVLQ-RDSAKLLHQGDHPGPTVELTFWTKQKENLIGIQKQVKVQL 248

  Fly   255 GDRRIKTIGFVLEKIQSIFEHSYRRIVELV---------LESLAEARDITKCLSPLKRKMDKFET 310
            .:.::..:..:|.:|:|.:...:..|::.|         ..::.||.||...|..|:|.:..|| 
Zfish   249 QNPKVDQVLEILRRIKSSYYTPFDDIIQKVNYVYCLLIDFPAVMEAEDIDLHLKTLRRPIAAFE- 312

  Fly   311 NDMDENRSDIRPLM----LTIGLVWGHSRYF-HTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQG 370
               :.:.:|:.||:    .|:.|:|.||.:: |....:||... |.|.|||..:..:.|:.:|:.
Zfish   313 ---ERSFTDLEPLIPALFHTLALIWTHSDFYCHPARIVTLLTE-FCNLLIDKASVYLIPEELFKM 373

  Fly   371 DVDEAYKKLDINMQHLEYYKLIYNECRNSLKK----FKIGTTFNSQDWTWHQDEIFGRLDKFLVR 431
            :::|...::...:|....:|..:...|:.|..    .:.|.|.  :.|.:..:.:|.|.|..:.|
Zfish   374 ELEEGMDRVRKAIQVFCSFKRSFQLHRDKLTPTGPYSRPGLTV--KPWDFPIELVFHRTDSIMER 436

  Fly   432 LEELK-------------------------DLFNTVRDFQKLEKIVMGGLKGRQITFALEKILEE 471
            |..::                         :||.:..||.|||:|.:||.:|:.::..:..:.:|
Zfish   437 LRMIEVCALKYIKELTKNMSASKRSRIHSLELFASALDFLKLERIELGGSRGKILSEMVYNMNDE 501

  Fly   472 YNSIYREWTNIQYNPIDPDAENSLF---QRDRLSFK---------------AKTDVMERM----- 513
            :...:|.....:|:|:  |..|.:|   .:..|.||               ...|..:|:     
Zfish   502 FLDSWRTLRESKYDPL--DYNNKVFTCLHKYTLPFKPYFFEFMSDYKRFMEQNQDFDQRLGTVIN 564

  Fly   514 VSFQFEKGLEDTHDLL-LAGSLLLRPIIKKHVEPLMHVIVDDFEEEI-MC-----VKKEFINFKN 571
            ::||...|||....|| :.|:||.||.:.:...|....::..|:||: :|     .::|  ..:.
Zfish   565 LAFQHSPGLESAFKLLQMFGTLLERPRVHQLFAPNYSQLLVMFQEEVSLCQRILDTQRE--KLRT 627

  Fly   572 VFTALGLNELPTDDCFPKVSGAISFLKKLRHRII-GLHKEHELYEYPLFDNERGGYVSDIFNIMV 635
            ....||.|       .|.|:|.:.:.::||.||: ...|..:|...|| ::.....|..:...::
Zfish   628 GSPILGKN-------MPAVAGNLKWSQELRERILSNRSKLSQLTHMPL-ESSEAKQVLQMCECVL 684

  Fly   636 QEIDDFTKMLLDKWTVECWQGIQQDITLTLIEKDEANEL-RVNFTERLIFALKDIKVVRLLGCDV 699
            :.:|...:.:.:.|:|...:..|..:...|:..||.:.| .:||...|:..|::.|   .||...
Zfish   685 EVLDVMDEEVYNNWSVGMDELCQTHLNKPLLILDEESSLYSLNFNPALMSVLREAK---YLGILK 746

  Fly   700 SVNLTK----FFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFI 760
            :.|:.|    .:.:.:.|......|::|.:|||.........|.||:.:|:..:...:||.|..:
Zfish   747 NHNIPKAAVSLYSKREMLHMYTSTLLQITQWYNKLHSTILAVELRLVESELEEVRNTLKPALQEL 811

  Fly   761 KW-NAFSQRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLH-TDPR 823
            :| :.....:|.....:|:.:.:|:..::.|||.::..:..:.......||..:...||: ||..
Zfish   812 QWIDEDLADYIKSTCDLVRGVSERVQKSKANLEKLQGLMGVFSHSACITRKTSHRGNLLNLTDVE 876

  Fly   824 EPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTS 888
            |                       |.|      |:|.|                           
Zfish   877 E-----------------------NFK------RQYGL--------------------------- 885

  Fly   889 VKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAEN 953
                    :....:.:.|..:|.:|              |.|...:..| ::.|..|||..|...
Zfish   886 --------IARTGEKIHELVQENAE--------------LLGADLDSEA-WQSYTEYVDRHILTG 927

  Fly   954 LVDSVITSSTYLRMEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNN 1018
            ...:|..|..|| :|..:...:..|:||:.:.| ..::::..:|:.|.|..|...|:.::.|:..
Zfish   928 FCSAVRCSLQYL-VENTDAALSIAPLFEVQLTL-TTDMIFHPSLNLSRKGNFYDIIDQMVSDIFK 990

  Fly  1019 MMSLLKRVAQDPTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLW 1083
            |.|.:||||:.....|.........||.:.::|.:.|.      :.|:..|:.....|..:..||
Zfish   991 MASFIKRVAKSKQSETYKEDVDQIPELVELAQLVRYRA------RGAIAKVKEFQHSFDSYRYLW 1049

  Fly  1084 IWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTW 1148
            ..|::.::.:...:|..|:.:|.:..||.|       |....|.|..::||:.:|.:|.:::|..
Zfish  1050 TGDRAEFMRQFLLYGHALSAEEAELYADYE-------LPKNPPKLQNFREQISEFEDLYEKVRVL 1107

  Fly  1149 ETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKD 1213
            |....|..:.::::..||.::::.:.:|..:||..|:|.|..|::||..|::..|:.|...:...
Zfish  1108 EEKRVFCGWCQVDINPFKRSLMNIIKKWSWMFKEHLLNHVNASVQELGSFIESTNLGLAKTVTDG 1172

  Fly  1214 DFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLA 1278
            |:..||.|:|.|..|.::|...:.:|.|||...|||:.||.:..:.....:..||:.|..:|::|
Zfish  1173 DYGKLVDIMSHLKAIRDRQMSTEQLFRPLKATSDLLKTYNQQLPEHVYILLEALPEKWKNLKKVA 1237

  Fly  1279 ATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEE 1343
            .|.|..:||:||.:|.:|.::.:..:...:.:|::|.|:..||:.....|:|||:::..:..||.
Zfish  1238 FTVKHEVAPLQSNEVAVIRRKCVRFEIKQHEFREQFRSEPIFFIRLEEPYKLIDKTNRAVAHLES 1302

  Fly  1344 RQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQE 1408
            ....|.::|.|||:..||..::..||.|:.|||.:||..:.::|:|:||.|||||:|::|.||.|
Zfish  1303 EMAKLQQTANLFEVSFPDYKQLRQCRSDIILVKAVWDMVMFVKSSISDWTKTPWKEINVEQMDME 1367

  Fly  1409 CKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMD 1473
            .::|.:|::.|||.:|.|:.:..:|:.:|||:||||||.||||.|:|:|||.:||.||.|.|.||
Zfish  1368 LRRFAKEMKTLDKEVRVWDVYNGLESIVKNLLTSLRAVNELQNSAVRERHWQQLMHTTGVSFVMD 1432

  Fly  1474 DSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKAS 1538
            ::|||.||::|.||..||||||||||:||||.:||.|.:|...|..|....::|..|...||||.
Zfish  1433 ENTTLGDLLELQLHRVEEEVKNIVDKAVKEMGIEKILGEIQQTWSMMSLSYEMHTSTGTPLLKAD 1497

  Fly  1539 EELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSE 1603
            |.||:||||:|.||||:..|||:.:|..||..||.:|..||.:||.|..|||.|.:|:|||..||
Zfish  1498 ENLIDTLEDNQVQLQNILMSKYVEYFMVEVSGWQRKLVVADLVIGIWLAVQRTWAHLQSIFTNSE 1562

  Fly  1604 DIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDY 1668
            |||:||...:.||..|.::|:..:..:....||::.||:.|  ..|.||.|.:.|.:|||||.:|
Zfish  1563 DIRNQLAHVAERFQGIHQDFQGSMISIVETDNVIKVTNQPG--FLEQLETLQQRLSVCEKALAEY 1625

  Fly  1669 LETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLISGSKN---------AA 1724
            ||||||::|||||||::|||:|:|.|..|..|.|||.||:|::..|:......|         |.
Zfish  1626 LETKRLTFPRFYFVSASDLLEIVSKGTQPRQVTRHLLKLFDNLADLSFKEEKDNGELDPQTTIAL 1690

  Fly  1725 GMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQP 1789
            ||.::| .|||||.:.|.|.|:.|.|||.:...|..|:|.::..::..|:.|||..|:|::|||.
Zfish  1691 GMYSRE-GEYVPFSQPCVCEGQAECWLNALEKAMCSTVRQEISEAVAAYEDKPRDQWLFDYPAQV 1754

  Fly  1790 ALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTID 1854
            ||.|:||.|.|:...||.:|::.:|.||||||:|||:|||:||.:|||:||..:|||||||.|||
Zfish  1755 ALTGSQIWWATDVGIAFERVEEGFETALKDYNRKQISQLNSLINMLLGELTPGDRQKIMTISTID 1819

  Fly  1855 VHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPL 1919
            ||:||||..:|::||....||.|.|||||||..:...|:.|||||||::.|||||||.|||||||
Zfish  1820 VHARDVVAKLISQKVTSGQAFAWLSQLRHRWAEQQKHCYINICDAQFQFSYEYLGNTNRLVITPL 1884

  Fly  1920 TDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLA 1984
            ||||||||||||||.|.||.:||||||||||||||||:||:|||||||||||||||||:|:||||
Zfish  1885 TDRCYITLTQSLHLTMSGATSGPAGTGKTETTKDLGRSLGIMVYVFNCSEQMDYKSIGNIYKGLA 1949

  Fly  1985 QTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAG 2049
            |||.|||||||||||||||||||||||.||||:::|||.|.||||.|.||:|||:|||:||||||
Zfish  1950 QTGVWGCFDEFNRISVEVLSVVAVQVKTIQDAVRNKKQRFHFLGEDIELRSTVGIFITLNPGYAG 2014

  Fly  2050 RAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWG 2114
            |.|||||||||:||||||:||:.||.||:||||||.:|||||||||:||||||||||||||||||
Zfish  2015 RTELPENLKALFRPCAMVIPDYELICEILLVAEGFLDARLLARKFISLYTLCKELLSKQDHYDWG 2079

  Fly  2115 LRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRN 2179
            ||||||||||||:|:|:||..||:|||||||||||:||:||.|||:|:|||.||||.||:||||:
Zfish  2080 LRAIKSVLVVAGSLKREDRSCPEEQVLMRALRDFNLPKVVTSDVPIFLGLISDLFPLLDIPRKRD 2144

  Fly  2180 PEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKR 2244
            ...|..:::|..:|.||||:.||||:.|||||.|||||||::|..|:|||::.|||:|||.|.|.
Zfish  2145 HLLEQNVRQSVAELHLQPEESFILKVTQLEELLAVRHSVFVVGGPGSGKSQILKTLHKTYSNMKL 2209

  Fly  2245 KPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESL 2309
            ||.:.|:||||||.|||||.::|:||||||||||..||:.:.:...|||||||||||||||||||
Zfish  2210 KPIWTDINPKAVTTDELFGFLHPATREWKDGLFSSTMRELSGISHDGPKWIVLDGDIDPMWIESL 2274

  Fly  2310 NTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLG 2374
            ||||||||||||||||||:|...|||||||:.|:.|||||||||||||:|||||||:.::.||:.
Zfish  2275 NTVMDDNKVLTLASNERISLAPSMRLLFEISHLKAATPATVSRAGILYVNPQDLGWSSYVTSWID 2339

  Fly  2375 TRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDCPKD 2439
            ||...||.:.|.:|||||||..|:..|..|::||||.:.:.:|..|.|||.:||.:|.|.|.|::
Zfish  2340 TRQAQSERANLTILFDKYVPYCLEQVRCNLKTITPIPETSMVQTLCCLLDCLLTDENTPPDSPRE 2404

  Fly  2440 WYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWT 2504
            .||:||||..||.||.:||||.:||:.:|||:|:..|.:|||||..|::|.:|||..||:|.||:
Zfish  2405 LYELYFVFASVWAFGGALFQDHLIDYRSEFSRWWCKEMRAVKFPSQGSVFDYYIDPNTKRFTPWS 2469

  Fly  2505 NLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSD 2569
            ...|.|||:.|:|||:.||::|||..|.:|::.|::...|:||:|.:|.|||||:..|:|.| .:
Zfish  2470 ERTPPFELEPDIPLQTVLVHSAETICLTYFIELLLQKGKPVMLVGNAGVGKTILVWDKISKL-KE 2533

  Fly  2570 KYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTL 2634
            ::.|..||||:||||.||||:||||||||||||:.|.|.|::||||||:||||||.|.|||||||
Zfish  2534 EFMVAKVPFNYYTTSAMLQRVLEKPLEKKAGRNFAPPGTKKLIYFVDDLNMPEVDAYGTVQPHTL 2598

  Fly  2635 IRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILN 2699
            |||.:||.||||||::.|::||.|..:.||||:||||:|:|||||||..|||:.|..|||..|.:
Zfish  2599 IRQHLDYSHWYDRQRLVLKEIHNCQYITCMNPTAGSFSINPRLQRHFSVFAVHFPGADALSTIYS 2663

  Fly  2700 SILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLY 2764
            ||||.|...  ..:...|.::...:|..||.||.|:..:||||||:|||.||||||::||.|:|:
Zfish  2664 SILSGHFQQ--GGYSYGVSRMSSTLVQAAICLHQKMSQNFLPTAIRFHYIFNLRDISSIFQGILF 2726

  Fly  2765 SNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVYAQPLIYC 2829
            :..|.......::.||:||..|||.|||::..|:..|.||:.|..::..||:::.:...|||||.
Zfish  2727 ALPEHVRYPIDLVHLWLHESSRVYSDKLMEEKDVELFNKILLDTGKRYFEGIDESIFINQPLIYS 2791

  Fly  2830 HFAKGLTDIKYMPISGWDRLKSLLDEAQDRYNDYIGAMNLVLFDDAMSHVCRISRILESSRGYAL 2894
            |||.|:.:.:|..::..::|:..|.:|.:.||:....||||||::||.|:|||||||||..|.||
Zfish  2792 HFAHGVGEPRYAQVTDLEKLQKTLMDALEHYNELHSDMNLVLFEEAMQHICRISRILESPVGNAL 2856

  Fly  2895 LIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEV 2959
            ||||||||||||.|||:|:|.|:||||.|.|.|.:|||:::||.||:|.|||.....||.||:::
Zfish  2857 LIGVGGSGKQSLCRLAAFLSVLEVFQITLRKGYGISDLRSDIAALYIKVGVKNIGTVFLHTDAQI 2921

  Fly  2960 AREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVV 3024
            ..|:||||:||:||||||.:||.::|::.||.::|.|::.||::|.|||||.:||:::|..||||
Zfish  2922 PDERFLVLINDMLASGDIPDLFSEEEIDMIVTSIRVELRALGLLDTRENCWNFFIDRIRRQLKVV 2986

  Fly  3025 LCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAF 3089
            |||||||.|||.|:||||||||||.|||||.|||.||:|||..|:..|..|..::.:.:|.|::|
Zfish  2987 LCFSPVGFTLRTRARKFPALVNCTVIDWFHPWPQHALQSVSSTFIQNIPDLEPDVRVSISEFISF 3051

  Fly  3090 VHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKE 3154
            .|..||::|..|..|.||:||||||||||.:.||..||..|......:..||||||.||.:...:
Zfish  3052 AHTCVNEVSVKYQQNEKRFNYTTPKSFLEFMKLYGNLLGSKRTELRQKTERLENGLQKLLTTASQ 3116

  Fly  3155 VDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCE 3219
            |:.|:..|.:|||||.::|.:.:.||..:|.::||:|:||:.|..|||.|..|:.:||.:.:..|
Zfish  3117 VEDLKAKLAIQEVELHLRNTDTEALIAKIGQQSEKLSQERSVADAEEKKVEAIQAEVTKQQQETE 3181

  Fly  3220 EDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACR 3284
            .|..||:|||.||..||||||:.|||||::|.:||..|.:|..|||||.|..|:|||||||||.:
Zfish  3182 ADLEKAEPALQAANAALNTLNRLNLTELRTFPNPPAIVSNVTAAVLVLLSPNGRIPKDRSWKASK 3246

  Fly  3285 AFMGNVDKFLDNLINYDKKHIHPDVIKALQ-PYILDAEFSPEKILAKSSAAAGLCSWVININRFY 3348
            ..|..||.||..|:|:||:.|....::.:: .|:.|.||:||.:..||||||||.:|||||.||:
Zfish  3247 VVMSKVDDFLQALVNFDKERIPEATVRVIKDEYLSDPEFNPEFVRLKSSAAAGLSAWVINIIRFH 3311

  Fly  3349 DVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKT 3413
            :|:..||.|...|.::..::.:|.:||..:..:|.||:..|..|...:::|.::|.:||||.::|
Zfish  3312 EVFCEVEVKRLCLAQANADLVEAAEKLEIIRKKLAELDGSLETLTAAFEKATSEKLRCQDEVNQT 3376

  Fly  3414 AFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLW 3478
            ..||.:||||:.||.:|.|||..||.........|.||:|:.:.||||.|.|::.||.||...||
Zfish  3377 NTTILLANRLVKGLESENIRWAHSVAQYREQESTLCGDVLLTAAFISYAGSFSKRYRYELLHNLW 3441

  Fly  3479 MPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQ 3543
            ||..:..:.|||.::|.||..|:.|||.||:|||:|||.|:||.:||.||...||:||:||||||
Zfish  3442 MPYLRAQKVPIPMSEGSDPISMLTDDATIAKWNNEGLPGDKMSTQNATILTNCERWPLLIDPQLQ 3506

  Fly  3544 GIKWVKTKYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTVL 3608
            ||||:|::||..|.|:.|||:.|:|.:|:||.:|..:||||:.|.|:||::|||||..||||..:
Zfish  3507 GIKWLKSRYGNSLKVINLSQKGYVDVIEQAVVSGEPVLIENLEETIEPVIDPLLGRHTIKKGRCI 3571

  Fly  3609 KIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAM 3673
            |:||:|..|:..|||||||||||||||||:|||||||||||||||||||||||||.:||||||.:
Zfish  3572 KVGDKECYFHPDFRLILHTKLANPHYKPEIQAQTTLINFTVTRDGLEDQLLAEVVNLERPDLEYL 3636

  Fly  3674 RTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGV 3738
            ::.||:|||.|||.||.|||:||.|||:|..|.|.|..||..||.||.||.|||:||.|||:..|
Zfish  3637 KSELTKQQNMFKIELKQLEDELLTRLSAAESNFLGDNVLVEKLESTKHTAAEIEMKVLEAKVNEV 3701

  Fly  3739 QIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLI 3803
            :|:.|||.|||.|.|||::|||:|||.||||:||||||||.|||:.|:..|.|:..:|.||..||
Zfish  3702 KINEAREHYRPVAVRASLLYFIINDLNKINPMYQFSLKAFNVVFHKAVQNADASADVKIRVNTLI 3766

  Fly  3804 DSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNFTWLTHV 3868
            |.|||.:|.|.:|||||:|||.|..||..|:|:...||:|.||||||||....:..|...:|::.
Zfish  3767 DCITFSTFNYINRGLFERDKLTFAAQLTFQLLLMNKEVDPRELDFLLRFNIDHSYISPLDFLSNS 3831

  Fly  3869 GWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGKSAIQRLCIMRCIRPDR 3933
            .|..::.::....|:||::|||||.|||||.|:||.||.||.|.|||.||::|:|.::|.:||||
Zfish  3832 VWSAVKTMSFTDEFRGLDRDIEGSPKRWKKMVESECPEKEKLPQEWKSKSSLQKLILLRALRPDR 3896

  Fly  3934 MSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDH 3998
            |:||:|:|:|||||.:|.:.|.|||:|:|:|..|.:.:||:||||||||||||.|||.|||:.|.
Zfish  3897 MTYAVRNFVEEKLGVQYTEGRKMEFARSFKECGPASPVFFILSPGVDPLKDVESLGKKLGFTIDL 3961

  Fly  3999 ENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSLSNVHTSYRLFLS 4063
            ...|:||||||||.|||.|:|.||:.|||||||||||||:||.:|||.:|....:.|..||:|:|
Zfish  3962 GKLHNVSLGQGQESVAELAMEKASREGHWVILQNIHLVAKWLGNLEKLLEHCCEDSHQDYRVFMS 4026

  Fly  4064 AEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCY 4128
            |||:..|..||:||||||::|||||||||||:||:|.|||||..:.|:.||:|.|||.|||||||
Zfish  4027 AEPSPTPQEHIIPQGILENSIKITNEPPTGMLANLHAALDNFDQDILDQCSREQEFKTILFSLCY 4091

  Fly  4129 FHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDD 4193
            |||.||||||||||||||.||||.|||||||.|||||||||::||||||||||||||||||||||
Zfish  4092 FHACVAERRKFGPQGWNRKYPFNTGDLTISVNVLYNYLEANSQVPWEDLRYLFGEIMYGGHITDD 4156

  Fly  4194 WDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAEIG 4258
            ||||||||||||:|||...|.::....||..|..|.|.|||.|||:.||.|||..||||.||||.
Zfish  4157 WDRRLCRTYLEEYMQPNQFDRKMSLAPGFIVPSNLDYQGYHAYIDEMLPHESPVHYGLHPNAEIE 4221

  Fly  4259 FLTTVSERLFRIVFELQPRMTGGSSGGETVSQ--EDIIKNIIEDILDKTPTPFNILELMGRVEDR 4321
            |||.:|:.||..:.|||.|   .||.||..||  |:.:|.|::|||:|.|..:|:.::..:..:|
Zfish  4222 FLTVMSDSLFHTLLELQSR---DSSMGEGASQTTEEKVKTILDDILEKLPEEYNMSDITSKTAER 4283

  Fly  4322 SPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPS 4386
            ||:|:|.||||||||.|:.|::|||.||||||||||.|||.||.:...|:.|.||:.|.:|||||
Zfish  4284 SPFILVCFQECERMNMLINEIRRSLKELDLGLKGELAISSEMEQIQTALFFDNVPDTWARLAYPS 4348

  Fly  4387 MLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNC 4451
            :..|..|::|::||.|||:.|..|..:||.:|::|.|||||.|||:||..|||||||||:|.|..
Zfish  4349 IYSLGQWYNDVLLRCRELDSWTHDLSLPSVVWISGLFNPQSFLTAVMQSLARKNEWPLDKMNLTV 4413

  Fly  4452 DVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIK 4516
            |||||:|||.....||||||.||:|||||||::.|||.:|.||||.|:|||:.::|:..|:|:.:
Zfish  4414 DVTKKFKEEFNQPAREGAYIYGLYMEGARWDIQGGTITEARLKELTPSMPVIAVRAIPNDRQETR 4478

  Fly  4517 NVYECPVYKIRLRGPTFVWTFNLKSRERASKWTLAGVCLLL 4557
            |.|||||||.:||..|::|||:||||||.:||.||||.|||
Zfish  4479 NTYECPVYKTKLRANTYIWTFSLKSRERPAKWVLAGVALLL 4519

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 147/650 (23%)
DHC_N2 1368..1770 CDD:285579 199/411 (48%)
P-loop_NTPase 1903..2132 CDD:304359 193/229 (84%)
P-loop_NTPase 2217..2352 CDD:304359 96/135 (71%)
P-loop_NTPase 2510..2783 CDD:304359 150/273 (55%)
P-loop_NTPase 2860..3127 CDD:304359 159/267 (60%)
MT 3140..3480 CDD:289543 156/341 (46%)
AAA_9 3509..3722 CDD:289547 139/213 (65%)
Dynein_heavy 3864..4549 CDD:281078 422/687 (61%)
dnah9lXP_021333021.1 DHC_N1 189..821 CDD:312031 147/655 (22%)
DHC_N2 1331..1734 CDD:312039 196/406 (48%)
P-loop_NTPase 1868..2097 CDD:328724 193/229 (84%)
P-loop_NTPase 2182..2317 CDD:328724 96/135 (71%)
P-loop_NTPase 2475..2745 CDD:328724 150/273 (55%)
P-loop_NTPase 2822..3089 CDD:328724 159/267 (60%)
MT 3101..3445 CDD:330758 157/344 (46%)
AAA_9 3472..3686 CDD:315453 140/214 (65%)
Dynein_heavy 3824..4518 CDD:308587 427/697 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1463at33208
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.