DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dhc98D

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_524541.3 Gene:Dhc98D FlyBaseID:FBgn0013813 Length:5080 Species:Drosophila melanogaster

Alignment Length:4819 Identity:1395/4820 (29%)
Similarity:2299/4820 (48%) Gaps:666/4820 (14%)


  Fly   136 GWTNVIANDMKTESQ--------------------EMRNGIAQMKGLVINRTIFPLPICMDEVMQ 180
            ||...:...|||.:.                    |:...:.|:|      |.|.:.:.......
  Fly   531 GWIKYLKKTMKTLTDAKLDDFTPMAEHRYWHKMEVELYGTLEQLK------TEFVVAVLQRLTDD 589

  Fly   181 AAPAIAMGDISVVNPLMKHSLEFMVVK----WLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWE 241
            .:|.:.... :||.   |....|.:.|    :|.::.|.:     ||:.|.|:|.:.        
  Fly   590 KSPVLDEWQ-AVVE---KTEARFKLAKENSDYLGTIIDYL-----EKVRSYESFKMV-------- 637

  Fly   242 SRLENLENLAEQLGDRRIKTIG-------------------FVLEKIQSI--FEHSYRRIVELVL 285
              :..:.|:  .:|.|.|.|:.                   || :|::||  ||:.::.......
  Fly   638 --VLQIPNI--MVGLRHIWTMSSHYCRDPEMQVLLCQISNVFV-QKVKSIINFENIFKYSATYTY 697

  Fly   286 ESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLMLTIGLVWGHSR--YFHTLNNM----- 343
            |:.....::.:|.    ::..|.....::::.:..|         |...|  .|:.:|::     
  Fly   698 ETATNCANLLRCW----KQAYKLSRQHIEDSGAGSR---------WEFDRVALFNEVNHIHRVAV 749

  Fly   344 ---------TLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINMQHLEYYKLIYNECRNS 399
                     ..:.|||.:.|..|:   .:| ||....:.:.|:.||..::.::|           
  Fly   750 DIAYVGRVFVQYENLFGHRLKACI---ADP-SIVDNLMRKVYRMLDDLIKSVDY----------- 799

  Fly   400 LKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKLEKIVMGGLKGRQIT-- 462
             ..|:.|   |.::|.:       .|:.|..||:.:::....|.| |.:..: :...||..:.  
  Fly   800 -DMFRPG---NWENWEY-------SLELFNKRLDNVENEAKNVID-QSINSL-LSSEKGLDLVVN 851

  Fly   463 ------------FALEK-------ILEEYNSIYREWTNIQYNP---------------------- 486
                        |...|       .:.|.|::.|.:|.::.:|                      
  Fly   852 AMNIDTRATLQEFVATKHENLLRFFVTEINAVERVFTKLKKSPPMAKHQPAKISAIFWARLLGKK 916

  Fly   487 ------------IDPDAENSLFQRDRLSFKAKTDVMERMVSFQFEKGLEDTHDLLLAGSLLLRPI 539
                        .:|..:||..:|.  |||...::|  .|.|||||.|.:  :.:...:.|:...
  Fly   917 LKTSVLAFKRVEDEPAIKNSFLKRS--SFKQYFELM--TVMFQFEKVLFE--NFIQNATYLVNTT 975

  Fly   540 IKKHV-------EPLMHVIVDDFEEEIMCVKK------EFINFKNVFTALGLNELPT-DDCFPKV 590
            .:.:|       |..|..|    .|.:..:|.      :..:.:.|......|.:|. .:.|...
  Fly   976 NRSNVLRIRICKESTMSYI----SEAVQTLKAKPRPELQMTSDRRVTPVKSSNLMPVQSEAFSAY 1036

  Fly   591 SGAIS-------------------FLKKLRHRIIGLHKEHELYEYPLFDNERGGYVSDIFNIMVQ 636
            |.|.|                   ..|||..||..|.....:..:.:.:..:.       ||.:|
  Fly  1037 SVADSAGTEISSESENEGLLVGDTSQKKLMCRINRLTVLVAMIMWMVSNTRKA-------NIQLQ 1094

  Fly   637 EIDDFTKMLLDK-------------WTVECWQGIQQDITL----------TLIEKDEANELRVNF 678
            |...|.||:.||             .|.|..|..:....|          ||||.|  .:..||.
  Fly  1095 ECTAFIKMVKDKKPKDVTAMDRHCVRTCELLQRAESQYLLPIWRELVGEKTLIEYD--MDFVVNL 1157

  Fly   679 TERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIA 743
            ...:...|.:.:....||..:...|.....::|.|::...::..:.:.|....       ..|..
  Fly  1158 KRDVFDVLFEAQQFEHLGFTLPAVLRTAIMKKDLLFKDYERMTEVVDRYRSII-------NNLSM 1215

  Fly   744 AEMILIEEQMKPLLDFIK-------WNAFSQRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSW 801
            :|:|.:...:.....||:       |.:|:      |.|....::.:|    ..|.:|...|.  
  Fly  1216 SEVIFLRGHIYDTELFIQMGVGRYTWTSFN------IGKFCDQINSQL----RKLTSIVSQIN-- 1268

  Fly   802 GKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEH 866
                 |.|.||...:       :.|.|....|..|..::.|.                |...||.
  Fly  1269 -----FIRLDLRSRI-------DMIKSFNLFNLDDELKVEDT----------------SRSSGES 1305

  Fly   867 GEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRY-ELLKG 930
            ..:|.::..  ....|::..|...|..:::|..:|      :.||:....  |.|...| |||:.
  Fly  1306 YLQDRKNPS--QRFKSVTGETITMFSVEKDVPADE------KAEQACGSG--IYPCQGYFELLEA 1360

  Fly   931 LSQEERALFREYEIYVDEIIA--ENLV--------DSVITSSTYLRME-----VDNRYEN----- 975
            ....:.|..::....:..::.  |:||        |.:.|...|...|     ||..|:|     
  Fly  1361 SRNRKAAQMKKLYDSLGPVLVKLESLVLGTFSGRSDRMKTYYEYWEGETFKCIVDMTYQNLKCYI 1425

  Fly   976 -----NTPIFEIFMEL------QEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQD 1029
                 |.|:||:...|      .||:|...:|              ||:....:.:|.|:...:.
  Fly  1426 NRLLSNKPMFEVNAVLLMSEIVLEPSVQELQN--------------TIVTATKDYISRLRIFTRW 1476

  Fly  1030 PTEVTNMNP-----------YSFY-DELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFM----E 1078
            .|......|           |::| |.:|.:|.:|.    ::|...|| ..|....:||:    :
  Fly  1477 MTGTCIACPLVEMGKQFKYNYTYYEDVIQIRSIVDL----VINIHDLA-SRVANEARGFVSQFRK 1536

  Fly  1079 FSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQD 1143
            :.:||.::|| ::.: |...:.:||.|.|                         |:...:..:.:
  Fly  1537 YFNLWAFEKS-FICQ-KFLEKQVTLIEID-------------------------EKFTFYSSIVE 1574

  Fly  1144 QIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVL-K 1207
            .:.....::| ...:|:|:.....::......|.:....:|:..|.::::.:::.|...::.| |
  Fly  1575 TLANTRKFQD-IKCVRINLEPLLASITQHAQDWCTTLGEELLRHVNDNMRAMRNEVKTLSLNLNK 1638

  Fly  1208 IELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWM 1272
            ...:.:||:   .:::.:..:.......:.....::|...:|.::...|...::...:.|...|.
  Fly  1639 TTRELEDFK---LVMTTIGTVQSSTLTNEQKIHEMQETFTILSEHKIMFPYEDMLMAHHLEKRWK 1700

  Fly  1273 KVKRLAATTKQLIAPIQSYQVDLIEKRI-LLCDNMANTYRKKFLSKKFFFVPCLSCYE------- 1329
            ::...|....:.:.||:....|:....| ..||::|     :|:..          |:       
  Fly  1701 RLFLSALYRYEKLQPIKQKFADMTSVEIDEFCDDLA-----EFIKD----------YDENGPGSV 1750

  Fly  1330 ---------LIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITI 1385
                     |:|....::...|.|:..||.:..||::...|..:....:.:.:.::.::......
  Fly  1751 GAELERGVRLMDPYGQKIAERESRREELANAERLFDMAMVDYHEFARVQTEFEGLQQLYKLYKAQ 1815

  Fly  1386 QSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQ 1450
            :.....|.||.|..:|...:.:..:.:.:|.|...||:||....:.:|..:|....::..:..|:
  Fly  1816 KYAREGWGKTLWADLDPNVLTEGVESYLKEFRKFTKAVRTLPVGVQLEIHMKQFKGTVPLMVSLK 1880

  Fly  1451 NPAIRDRHWIELMQTTKVKFSMDDST-TLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIA 1514
            :.|:|:|||::||:.|...|.|..:. ||:::..:.||:|:|..:.|:..::||:.:|:.::.:.
  Fly  1881 HEALRERHWLQLMEKTGQYFDMSPARFTLENMFAMQLHKYQEIAEQILTNAIKELQIERGVQAVI 1945

  Fly  1515 TAWGTMEFGTDIHDRTSIK---LLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLS 1576
            ..|.:|.|.|..|.:.|..   :|...:|:::.|||:...||:|.:|::|..|...|..|:..|:
  Fly  1946 ETWASMAFKTFKHFKGSDDRGWVLGPVDEIMQILEDNAMNLQSMGASQFIGPFLETVNKWERTLA 2010

  Fly  1577 NADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTN 1641
            ...:||..|..|||||.|||.||||. |||:||||::|:||.|||.::.::.....:..||....
  Fly  2011 LISEIIDEWLVVQRKWLYLEGIFIGG-DIRTQLPEEARKFDDIDKSYRRIMVDCAKNPLVVPFCT 2074

  Fly  1642 RSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTK 1706
            ..| :|.| ::.|...|..|:|:||:||::||..:|||||:|:.:||.||.: :.|:.|..|:.|
  Fly  2075 VPG-RLVE-IQGLGIGLENCQKSLNEYLDSKRRIFPRFYFISTDELLSILGS-SEPSAVQNHIIK 2136

  Fly  1707 LYDSMGKLNLI-SGSKN-AAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRS 1769
            :||::..|.|: .||:. ..||::.| .|.:.|..:...:|:||.|:|.:.|:||.:.|...|.:
  Fly  2137 MYDNIKSLRLVKEGSQTIVTGMISSE-GEVMEFRHSARAAGRVEYWMNDVLDEMRRSNRFINKTA 2200

  Fly  1770 LTFYD-----HKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYE-NALKDYNKKQITQL 1828
            :  ||     ...|..|:..:.....|..:|:.||.|..:||.:.|.... .|:||:..|...|:
  Fly  2201 I--YDFGTDLQISRPDWLMNYQGMVGLAASQVWWTAEVEEAFDQAQNHGNMRAMKDFLGKNNYQI 2263

  Fly  1829 NNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCF 1893
            ..|::.:..:|:..:|.|....||:|||:||::...:...|...:.|.|:||||..|....|:..
  Fly  2264 EELVLKVRSNLSRNDRLKFKAQCTVDVHARDIIDNFVRDNVLDASEFSWESQLRFYWIKFYDNLH 2328

  Fly  1894 ANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRAL 1958
            ...|...|.:.|||:|...||||||||||.|:|:||:|.:.:|||||||||||||||.|||.:|:
  Fly  2329 VLQCSGSFDFGYEYMGLNGRLVITPLTDRIYLTITQALLMNLGGAPAGPAGTGKTETVKDLAKAM 2393

  Fly  1959 GMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQT 2023
            |::..|.||.|.|||:::|.|..||.|.||||||||||||.:.||||::.|::.|::.:..|...
  Fly  2394 GLLCVVTNCGEGMDYRAVGTILSGLVQCGAWGCFDEFNRIDISVLSVISTQLQTIRNGLIRKLDR 2458

  Fly  2024 FSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEAR 2088
            |.|.|..|.|....|||:|||||||||.||||::|||:||...:.||..||..|.|.::||..|:
  Fly  2459 FVFEGVEIHLDPKCGVFVTMNPGYAGRTELPESVKALFRPVTCIKPDLELICLISLFSDGFLTAK 2523

  Fly  2089 LLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKI 2153
            :||:|...||:|.:..||||.|||||||::.|||.:||.::|.....||..||||.|||.|.||.
  Fly  2524 VLAKKMTVLYSLAQAQLSKQCHYDWGLRSLNSVLRMAGVMKRQSEDLPEAVVLMRVLRDMNFPKF 2588

  Fly  2154 VTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFIL------KIVQLEELF 2212
            |.:|||:|:|||.||||.:|.||...|:|.|.::...::      ||:||      |:||:.|..
  Fly  2589 VFEDVPLFLGLIKDLFPGIDCPRIGYPDFNAAVRHVLVN------DGYILLPDQEDKVVQMYETM 2647

  Fly  2213 AVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLF 2277
            ..|||..::|..|.||:.|...|.|...:.........|||||.:..||:|.::..||:|.||||
  Fly  2648 MTRHSTMLVGPTGGGKTVVINALVKAQTHMGLPTKCLVLNPKACSVIELYGFLDMETRDWIDGLF 2712

  Fly  2278 SILMRDQAN-LGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIAS 2341
            |.:.|:... :.....::...|||:|.:|||::|:||||||:||||:.|||.|.....||||:.:
  Fly  2713 SNIFREMNKPIEREERRYACFDGDVDALWIENMNSVMDDNKLLTLANGERIRLENYCALLFEVGN 2777

  Fly  2342 LRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYV------------- 2393
            |..|:||||||||::|::|::|.::||.|.|:.||..... .:||..|:|.:             
  Fly  2778 LNYASPATVSRAGMVYVDPKNLRYSPFWQRWVLTRPEPQR-ELLNDFFEKIITQSIAFILEGLDG 2841

  Fly  2394 -----PPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGF 2453
                 |..|.|.:|.|..:|...::....:..|::||....:.|..:...|..|..|:..:....
  Fly  2842 TTQGNPLKLVIMQTDLNMVTQFCNLYDALLPNYVMDSKNYDEPVQQNYNTDSLECCFLQAVYGSM 2906

  Fly  2454 GSSL---FQDQIIDWSNEFSKWFL------NEYKAVKFPLS-GTIFSFYIDHETKKFFPWTNLVP 2508
            |:.|   .|....::....|.:.|      |.....:||.| .|::.::.|.:...:..|..:|.
  Fly  2907 GACLVEKHQPVFDEYMKRISGFPLVQDTPENPASGGQFPQSKPTLYDYFWDVKDNVWKAWEWVVQ 2971

  Fly  2509 QFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSV 2573
            .:..|..:.....||.|.:.||....:..:.|...|::|:|.:|:.||..:...|..|......:
  Fly  2972 PYTHDPQVKFSEILVPTVDNTRTNRTLSLMSEIKRPVLLVGEAGTSKTATIMQYLRNLNPSVNVI 3036

  Fly  2574 TNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQF 2638
            .|:.|:..|:|..:|..||..:||:....|||...||:..|:||||||:||.|.|.||..|::.|
  Fly  3037 LNINFSSRTSSLDVQHTLEAAVEKRTKDTYGPPMGKRIACFIDDMNMPQVDDYGTQQPIALLKLF 3101

  Fly  2639 MDYHHWYDRQK-MTLRDIHKCNIVACMNPSAGSFT-IDPRLQRHFCSFAVNPPSQDALFHILNSI 2701
            .:....|||.| :..:........|.|..:.|... :|||....|.::.:..|:.::|..|.:||
  Fly  3102 FERGGMYDRDKDLNWKKFKDLTFYAAMGTAGGGRNEVDPRFISMFSTYNIIFPNDESLIQIYSSI 3166

  Fly  2702 LSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSN 2766
            ...||  ...||....:.:.:.:|...:.|...|:....||..||||.|||:|::.||.|:|...
  Fly  3167 FKGHM--VFVKFQPEYMLIADMIVHMTLKLFKMVIVDLPPTPSKFHYIFNLKDLSRIFAGMLLIE 3229

  Fly  2767 SETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFK----------------------------- 2802
            .........:||:|.:|..|:..|:|:...||.:.:                             
  Fly  3230 PTCFKGLRDLIRVWRNEYTRIICDRLITDNDIANVRRNLAVEVAERFPPTFEEEHGFIDAAAAEA 3294

  Fly  2803 ----KIVSDIVRKGIEGVND-------------------DVVYAQPLIYCHFAKGLTDIK---YM 2841
                :::.:..:..|:|..:                   |.|...||::..|.....:.:   |.
  Fly  3295 EAQARLLYEPSKADIDGGEEEGEEEEEGEEAPQVILSLKDYVLRDPLLFGDFRNFTNESEPRLYE 3359

  Fly  2842 PISGWDRLKSLLDEAQDRYNDYIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSL 2906
            .:..::.:..|..|..:.|.:....|.||||:|.:.|:.|:.|.|..:||:.||||||||||:.:
  Fly  3360 DLLDYNSVYFLFTEILEEYCERKQKMTLVLFEDCLEHLTRVHRTLRMNRGHVLLIGVGGSGKKCI 3424

  Fly  2907 TRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDL 2971
            ||||:|.:..|||:|.:::.|:.:..:.::..||..||||.....||.|.::||.|.||.|:|::
  Fly  3425 TRLAAFAAECDVFEITISRGYNEAAFREDLKVLYTIAGVKRKKVVFLFTGAQVAEEGFLELINNI 3489

  Fly  2972 LASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRV 3036
            |..|.:..||||::.:.|||.||...::.|:..:::..|.||:......|.||||.||.|..||.
  Fly  3490 LTVGQVPALFPDEDKDGIVNQVRKFAEEDGVSASKDAVWGYFLRTCAENLHVVLCMSPAGDALRN 3554

  Fly  3037 RSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLY 3101
            |.|.||.|:..|.|||...||:|||.:|:..||:|..::|......:...:..||.::...||.|
  Fly  3555 RCRNFPGLIGSTYIDWVFPWPRQALYAVAKLFLTEHRLIPASHREAIVEHVVHVHTSIQQYSKDY 3619

  Fly  3102 LANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQE 3166
            ||..:|.|:.|||.:|:.|..|..||.||.|....:|.||..|:.|:...:.::|.|:.::..|:
  Fly  3620 LAKLRRNNFVTPKHYLDYINTYRGLLEEKAKFITQQRSRLGEGIKKIEEASVQIDELRIIVTEQK 3684

  Fly  3167 VELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIA 3231
            ..:.:.::|.:.:::.:.:..:|.:.::|.||::...|....:.:..:....||...:|.|||..
  Fly  3685 KNVAVASEECEAMLVTIESSTQKANVKKAEASEKSVEVEIKGKQIAIEKDEAEEILAEAMPALEE 3749

  Fly  3232 AQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDN 3296
            |:.||:.|.|..:||::||.:||.||..||..|.:|   ||.  |:.:||:.:..|.:|: ||.:
  Fly  3750 ARLALSQLEKAQITEIRSFATPPAAVQVVCECVAIL---KGY--KEINWKSAKGMMSDVN-FLKS 3808

  Fly  3297 LINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERAL 3361
            |:..|.:.:....|...:.::.....  |.:...|.|.|||..:|..:..|:|||..|:||:..|
  Fly  3809 LMEMDCEALTQKQITQCRQHMKTGNL--EDMAKISVAGAGLLRFVRAVLGFFDVYKEVKPKKERL 3871

  Fly  3362 --LESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLI 3424
              |..|:||:  ...|..||..:.:|||:||.|...|..::.:.:...:...:....:..:::||
  Fly  3872 DFLVEEQEVQ--IKLLNHLNGEIQKLEEKLNELNENYATSMKQMRALTEMMQQAERRLIASDKLI 3934

  Fly  3425 GGLATEKIRWMESVKVLTFGIQQL---PGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQ 3486
            .||.:|.|||  |.::.:.| |||   .|..||.:.|::|.|.||..:|:.:....|:....:..
  Fly  3935 SGLTSELIRW--SKEMASLG-QQLIDSVGGCLISASFLAYTGAFTWEFRKAMVFDDWLEDIASLG 3996

  Fly  3487 PPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWV-KT 3550
            .||.....:|.:  :..|.:|::|:|:|||.|.:|.:|..:.:::.|:||.||||||.::|: |.
  Fly  3997 IPIQLPFKIDGY--LTTDVEISQWSNEGLPPDELSIQNGILTMRASRFPLCIDPQLQALQWIRKR 4059

  Fly  3551 KYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKG--TVLKIGDR 3613
            ::...|.||..|..::|.|:|.|:..|:.:|.|::.:.||||::.:|.:.:..:|  ..:.:||:
  Fly  4060 EFKNNLKVLSFSDSDFLKQLEMAIMYGTPVLFEDVDDYIDPVIDDILQKNIRIQGGRKFVMLGDK 4124

  Fly  3614 EIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLT 3678
            |:|::..||:.|.||.:||.:.|.:.|:..:||:|||:.|||||||:.||..|||||||.|..|.
  Fly  4125 EVDWDPSFRVYLTTKFSNPKFDPAVYAKALVINYTVTQTGLEDQLLSVVVGTERPDLEAQRESLI 4189

  Fly  3679 QQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSA 3743
            .|.:..|..|:.|||.||..||::..|:|::|.|:..||.||..|..:..::..|..|...|:..
  Fly  4190 AQTSENKQLLQQLEDSLLRELSTSTGNMLDNVELIETLENTKTKAGVVMEQLKLAADTAADIEVL 4254

  Fly  3744 REAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITF 3808
            |..|||||:|.::::|.|:|:..:|.:||::|.|:..||..::.||:....|..|:.|:|.::|.
  Fly  4255 RNGYRPAAKRGAVLFFALSDMATVNSMYQYALAAYLDVFVYSLRKAVPDASLNKRLNNIIKTLTE 4319

  Fly  3809 CSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLR--FPYMPNQTSN-FTWLTHVGW 3870
            ..:.|...|:||:.||:|..|:..::....|.:..:||||.::  .....::.|| ..||:...|
  Fly  4320 NVYCYGCTGIFERHKLLFSFQIATKLAQRDGILLQSELDFFIKGSIALTKSERSNPCKWLSEKSW 4384

  Fly  3871 GGI--RALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGK-SAIQRLCIMRCIRPD 3932
            ..:  .|.:...:|..|..........||::.|.|:||....||::..| :|.|:|..:||.|.|
  Fly  4385 EDVLKLAFDFPDIFGTLPDHFGRYLTEWKEWFDLENPEEVPCPGDYNIKCNAFQKLMFLRCFRVD 4449

  Fly  3933 RMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSL-GFSF 3996
            |:..::..:|.|.:...||....:.||..:|::|....:.||||.|.||..|:.||..:: |.| 
  Fly  4450 RIFRSINQYIVETMDEFYIMPPVVSFSAIYEQTSSTIPVCFVLSAGSDPTNDLIKLADTIVGMS- 4513

  Fly  3997 DHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSLSNVHTSYRLF 4061
               ||..:|||||||..|...::.|.:.|.|::|||.||:.|::..|||.:: .:.|.|..:||:
  Fly  4514 ---NFCHISLGQGQEKAALRLLDGAIKQGMWLMLQNGHLLIRFVRELEKHLD-RIENPHPDFRLW 4574

  Fly  4062 LSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSL 4126
            ::.:|.  |.   .|.|||:.::|:..|||.|:..|:.........|.||.|| ...|:.:::.|
  Fly  4575 ITTDPT--PT---FPIGILQKSLKVVTEPPNGLKLNLRSTYFKVRQERLESCS-HVAFRPLVYVL 4633

  Fly  4127 CYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLE--ANTRVPWEDLRYLFGEIMYGGH 4189
            .:|||||.||||:...|||.:|.||..|..:...:|..||.  ...::||..|:||.||:||||.
  Fly  4634 AFFHAVVQERRKYDKLGWNIAYDFNDTDFDVCTEILRTYLTRCGTGKIPWNSLKYLIGEVMYGGR 4698

  Fly  4190 ITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDN----LPSE------ 4244
            :.||:|||:...|:.|:|...|.|               ::..:|.|.|||    ||.|      
  Fly  4699 VIDDFDRRITNCYMNEYMGDFLFD---------------EFKVFHFYEDDNVDYCLPEEETILKE 4748

  Fly  4245 -------------SPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKN 4296
                         .|.::|||.|||||:.|..:..::..:.||||: ||..:||  :|::|.|.:
  Fly  4749 DYIAHIDKLPLVNKPDVFGLHPNAEIGYYTMAARNIWNSLIELQPQ-TGEGTGG--ISRDDFIDS 4810

  Fly  4297 IIEDILDKTPTPFNILELMGRVE-DRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTIS 4360
            :...||.|.|..|....:..::: ..||..:|..||.:|.|.|:..:|::|..|...:.||:.:.
  Fly  4811 VAAGILKKLPPAFETWRIRKQIQMSLSPTGVVLLQELDRFNLLVVRIKKTLELLRKAIAGEIGMD 4875

  Fly  4361 SVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNP 4425
            :|::::...|:...:|..|:|||..:...|.||...|.||..:.:.|..... |..:||:|...|
  Fly  4876 NVLDNIANSLFNGLLPAAWSKLAPATCKQLASWLEHLRLRAVQYKYWTLSGE-PLVMWLSGLHIP 4939

  Fly  4426 QSLLTAIMQQTARKNEWPLDRMCLNCDVTK-KWKEELTTAPREGAYINGLFMEGARWDMKMGTIA 4489
            ||.|||::|...|:|.|||||..|...||| ...:::...|..|..::||::||.|:|:....:|
  Fly  4940 QSYLTALVQIACRRNAWPLDRSTLFTYVTKFADPDDVEERPVTGCLVHGLYIEGGRFDLATNQLA 5004

  Fly  4490 DAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLR----GPTFVWTFNLKSRERASKWTL 4550
            .:..|.|...:.:|.::.:...:..::|.|..|||...||    |...|:..||.:.|..|.|.|
  Fly  5005 RSHPKVLVEELAILAVEPIEAHRLKLQNTYLAPVYTTSLRRNAMGVGLVFEANLATSEDLSHWIL 5069

  Fly  4551 AGVCLLLQT 4559
            .||||.|.|
  Fly  5070 QGVCLTLNT 5078

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 130/725 (18%)
DHC_N2 1368..1770 CDD:285579 132/408 (32%)
P-loop_NTPase 1903..2132 CDD:304359 128/229 (56%)
P-loop_NTPase 2217..2352 CDD:304359 58/136 (43%)
P-loop_NTPase 2510..2783 CDD:304359 84/275 (31%)
P-loop_NTPase 2860..3127 CDD:304359 109/267 (41%)
MT 3140..3480 CDD:289543 100/345 (29%)
AAA_9 3509..3722 CDD:289547 90/216 (42%)
Dynein_heavy 3864..4549 CDD:281078 237/720 (33%)
Dhc98DNP_524541.3 DHC_N1 523..983 CDD:285571 92/527 (17%)
DHC_N2 1798..2201 CDD:285579 132/408 (32%)
P-loop_NTPase 2338..2565 CDD:304359 127/227 (56%)
P-loop_NTPase 2654..2788 CDD:304359 57/134 (43%)
P-loop_NTPase 2976..3246 CDD:304359 84/272 (31%)
P-loop_NTPase 3378..3645 CDD:304359 109/267 (41%)
MT 3658..3989 CDD:289543 100/344 (29%)
AAA_9 4017..4233 CDD:289547 90/216 (42%)
Dynein_heavy 4374..5068 CDD:281078 238/724 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93272472
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.