DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and CG3339

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001036762.2 Gene:CG3339 FlyBaseID:FBgn0039510 Length:4842 Species:Drosophila melanogaster

Alignment Length:4911 Identity:2284/4912 (46%)
Similarity:3119/4912 (63%) Gaps:449/4912 (9%)


  Fly     4 EKEKKEPVDNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGGQL 68
            ::.:::..|.|.|....|.|.|||||.||||||:..::.|.:::|: .:.:::.::.|::.||.|
  Fly    24 QRVQRDYSDARLERVAAYTTTTMRLKPDKWTKMMACDDLRRIVVEW-QHGHRRVLVMTLSPGGDL 87

  Fly    69 YP---------------------------------------------------------SYSFPV 76
            .|                                                         |.||..
  Fly    88 VPRSCLSDLYLPYSVQSARGSIPSAMLPAEDEAMATVTAAVSAVVSATPGALLIPLPPASSSFTT 152

  Fly    77 R---PRYKVAYFIRYLT---PLHLTDENMLNSLLIGDL-LPNPLANLSILCDEVFFPLLNNTVNQ 134
            .   ||.|.|||:|..|   |  ||..|...|:|.||. :.:.:..:|:|.|:|..|||....:|
  Fly   153 LDGVPRGKCAYFVRRNTSDGP--LTASNFAESVLYGDFPVHSKIETMSLLFDDVLQPLLEQAQSQ 215

  Fly   135 VGWTNVIANDMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDI-SVVNPLMK 198
              |..::..|::...:|:||.:.::||...||||..|.:....|.:....::.|.: ..::|..:
  Fly   216 --WPAIVRKDLQARIKEVRNTLTEIKGKTNNRTILSLLVSPTIVEEVFAHVSQGHLRPALDPKFR 278

  Fly   199 HSLEFMVVKWLDSVEDLVNIKA-----GEKIYSKENFP-------LPEAIFSFWESRLENLENLA 251
            :.||.|.:.|...:.|:|..::     |....|..:.|       ||.....||.:|..||:|:.
  Fly   279 NLLEEMFINWTTQMHDIVLERSECQPLGSTTQSAGHQPKYITLVSLPAQEIGFWTNRKLNLQNIY 343

  Fly   252 EQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDEN 316
            |||.:...||:..:||:|:|::...|......::.:..||:|::..|.||.|:...|.:......
  Fly   344 EQLRESTHKTLAQILERIESVYYEPYATAFRKLVAAWLEAQDVSLWLQPLLRQTAAFNSVQFSNG 408

  Fly   317 RSDIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDI 381
            ...:.||:..:.|||.::||:.:...|::......|.|:......:|...:||||.||...|::.
  Fly   409 HDLVAPLVHIVHLVWSNARYYRSTQRMSVLLRCICNMLVHRAAEDLELQLLFQGDADEGLLKINR 473

  Fly   382 NMQHLEYYK---LIYNE----CRNSLKKFKIGTTF---------NSQDWTWHQDEIFGR-LDKFL 429
            .:..||.:|   |.|.|    .:..|.....|...         ..|.|.:..:::||: ||.|.
  Fly   474 TIAVLELFKQRMLDYKERYAGSQVLLPALSEGAAAVASSPSPDDQQQLWRFCHEDVFGQTLDGFS 538

  Fly   430 VRLEELKDLFNTVRDFQKLEKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDA--- 491
            ::|.||:.:|.....||:|||:.:|||:|:.:|..:.:|..|:..::.:|:|:.   ||..|   
  Fly   539 LQLLELRQVFEAAVQFQQLEKLEVGGLRGKILTERVREIFGEFKVLFEQWSNVD---IDLTATVA 600

  Fly   492 -ENSLFQRDRLSFKAKTDVMERMVSFQFEKGLEDTHD-------LLLAGSLLLRPIIKKHVEPLM 548
             :...|:|::..|.::..::|:.::....:..|..|.       .|:.||||.|..::..:..::
  Fly   601 SKWKCFRREQTLFFSRMQLLEQKLATVLLQAFEQCHSWMHLLRLTLMFGSLLQREAVRPELARVL 665

  Fly   549 HVIVDDFEEEIMCVKKEFINFKNVFTALGLNELPTDDCFPKVSGAISFL------------KKLR 601
            ..|:..::.|:..::.........:...||..||..:.||.::.|:.:|            |:|.
  Fly   666 PHILFIYDTEMEQLEDSVGEVLLGYEIRGLAALPLANNFPPIANAMMWLEQHISRCDEFGAKELS 730

  Fly   602 HRIIGLHKE-HELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVEC-----WQGIQQD 660
            ..:..|.|| .||...|:..|.    :....||:..::.:....:...|. ||     .||:.:.
  Fly   731 QLVEQLLKEKSELQTLPIQWNS----LLSRRNILTTKLSNLQMKIWISWH-ECVDKLIIQGLDES 790

  Fly   661 ITLTLIEKDEANELRVNFTERLIFALKDIKVVRLLGCDVSVN---------LTKFFCREDELWQA 716
            :   |....:.::|.:||::.|...||:.|.:..|....|::         |...:...|..|:.
  Fly   791 V---LSRSQDLSQLHLNFSQVLFTLLKETKYLLALQATGSLSGDLFQLPEPLLTLYGHRDAYWER 852

  Fly   717 RVKLMRIAEWYNDTFE-RAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKYL 780
            |::|::|.|:||.... .....|.:||..::..|:|.::.....:.|..::...:..||:..:.|
  Fly   853 RIRLIKIGEFYNGIRSGECAAAELQLIRNDLASIDEHVEVACQQLTWRNYNDELVAGIFEQSRDL 917

  Fly   781 HDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLM 845
            ..||..:..||:||..|:|.|.:.||.|| .|....||....::..:.:|.....:|:.|::.|:
  Fly   918 FARLQQSHGNLDAILASMRRWSREPLHQR-SLYGRNLLDLRHQQDRVRLRLLQCDETKMLLNRLL 981

  Fly   846 YVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEE 910
            ..|..|||:.             |.:|                  |:.....:..::.:.||.||
  Fly   982 IANFCLFFNY-------------ESQE------------------FQLYSRDLSVQEFIREFPEE 1015

  Fly   911 QSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRME------- 968
            |                        |..:.:|...|||:|...:.:::..|..||..|       
  Fly  1016 Q------------------------RRQYNKYLASVDELICREVREAMRISLEYLYKEMTATATA 1056

  Fly   969 --------VDNRYE-------------------------------NNTPIFEIFMELQEPNVVYF 994
                    ||....                               |:.|:||:.:||.|..:.:.
  Fly  1057 TTTPTAPPVDPGCSAGMARLVLQQITTPQATSTAGAGASGAPPTANDAPLFEVKLELTETEIRFS 1121

  Fly   995 RNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQD--PTEVTNMNPYSFYD-------------- 1043
            ...|.|.:..|...:|.:|.|:......:.|:..|  |:|....:..:..|              
  Fly  1122 PAFDASVENNFQQIVEQLLLDIKQTCDCMPRIVADNAPSEDDEDDDTATVDYEQELRWEPREDRA 1186

  Fly  1044 -ELQDKSELD--------------------------KQRVE------------IMNKIKLALQAV 1069
             |||::.:.|                          .|::|            |.:.:...:.|.
  Fly  1187 QELQERKKKDLELEQEQGDPKPQAVQFNLLAAAKAYSQKMECTADGLEMLERAIRDALADTVAAA 1251

  Fly  1070 RVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQ 1134
            ..:...|..::.||....|..|:...:..|         |.....|:|      .|..:..:|::
  Fly  1252 SAYAAKFQAYAFLWTQQSSEVLAACMQTAR---------EQTHHVSAG------GYAIMETFKKE 1301

  Fly  1135 LDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFV 1199
            ::.:.|:.|.|...|..|....:|.|::...|..:|:...:|..:.|..|:..|:.:||||..|:
  Fly  1302 IENYNEVHDAIDQCENRECINGWLALDIKPLKYGLLNLACKWSHMCKKWLLRYVQGTLKELNAFI 1366

  Fly  1200 DEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQI 1264
            ......|::.:.:.||..|:::|:::::|.|::...|::|.|||||:.||:.||.||:...|..|
  Fly  1367 ARGFETLQLHIARQDFATLLRVLAIMSEIREREPYADNVFKPLKEIMGLLKTYNVEFEPQLLRGI 1431

  Fly  1265 NELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYE 1329
            .:||..|.::|..:...::.:...:.:|...:...|.|.......|.::|....||.|||...|:
  Fly  1432 EQLPQQWQQLKHSSTVKQEALQDTRFHQQQRVTALIGLHTCHLQHYARQFQKMPFFRVPCPQVYD 1496

  Fly  1330 LIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKK 1394
            :.||..|.|.....:||.....|.|.::|.|||..::.|..:|:.||.:|||...|:|.|..|..
  Fly  1497 VCDEVYLRLHRFRRQQRLYTRWARLLDIQPPDPATLQFCEVELRRVKQLWDFVRVIESCIVAWHA 1561

  Fly  1395 TPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHW 1459
            |||..||.::|:.|||||.|:||.|||.:|.|.|::.:...|:.|:.||||:||||||||.:|||
  Fly  1562 TPWLLIDTDDMEHECKKFTRDLRTLDKCIREWAPYVHIVGVLRELVASLRAITELQNPAITERHW 1626

  Fly  1460 IELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGT 1524
            :||||.||:.:..:.||.|..|:.|.|..:||::||.||:::|||.:.|.|.:|...|..:||..
  Fly  1627 MELMQLTKLSYKCNKSTRLAQLLTLQLQHHEEDIKNTVDRAIKEMTVTKVLDEIKATWAHLEFEL 1691

  Fly  1525 D-IHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEV 1588
            : .|.|..|:|||.||||||||:|:|.||||:::||:|.:...::..||..|...|.:|.:||||
  Fly  1692 EQHHTRPHIQLLKVSEELIETLDDNQMQLQNISTSKHIEYLLDKLTHWQKVLGGIDTLIVNWFEV 1756

  Fly  1589 QRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEI 1653
            ||||.|||.|||||.|||:|||.|:..|:.||::|.||||::...|.|::...|....|.:.|: 
  Fly  1757 QRKWIYLECIFIGSADIRAQLPADAANFERIDEDFTALLAKVQEVRVVMQVVLRHDDVLAQLLQ- 1820

  Fly  1654 LLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLIS 1718
            |...|.:||||||||||||||::|||||:|:|||||||||||||.::.|||.||:||:.:|...:
  Fly  1821 LQHRLAVCEKALNDYLETKRLAFPRFYFISAADLLDILSNGNNPQVIDRHLIKLFDSILRLQYET 1885

  Fly  1719 GSKNAAGMVAKELEEYVPFLE-NCD------CSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHK 1776
            .:.||.||.:||.:|||||:. :.|      |.|:||:||..|..:||.||.:..:|:|..:..|
  Fly  1886 NTPNALGMHSKENDEYVPFVSFDPDQPAFIVCGGRVELWLRAIIQQMRSTLHELFRRALRVFGEK 1950

  Fly  1777 PRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTA 1841
            ||.:|:::||||.||..:||.||.:.|.:|..:::.||..:|:.:|:||.|||.||.||||:|:.
  Fly  1951 PRELWLYDWPAQVALCCSQISWTADVNRSFGCMEEGYEGVMKELHKRQIAQLNALINLLLGELSP 2015

  Fly  1842 AERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPK------------------ 1888
            .:|||||||||||||||||||.|||.||:...|||||||||||||..                  
  Fly  2016 GDRQKIMTICTIDVHSRDVVGKIIASKVDNSLAFQWQSQLRHRWDDDQAGSSSGRASTAISCGGG 2080

  Fly  1889 IDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKD 1953
            .:|||||||||:|||.|||||||.|||||||||||||||||||.|.:.||.||||||||||||||
  Fly  2081 DEDCFANICDAEFRYAYEYLGNTSRLVITPLTDRCYITLTQSLRLRLAGATAGPAGTGKTETTKD 2145

  Fly  1954 LGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIK 2018
            ||||||:|||||||||||||||.|:|:||||||||||||||||||.||||||||||||.||:|||
  Fly  2146 LGRALGVMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRICVEVLSVVAVQVKTIQEAIK 2210

  Fly  2019 SKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEG 2083
            ..|..|.|:||.|:|..:||:|||||||||||.|||||||.|:|||||:|||||||.||||:|||
  Fly  2211 MHKTQFIFMGERISLEPSVGIFITMNPGYAGRTELPENLKTLFRPCAMIVPDFALICEIMLMAEG 2275

  Fly  2084 FQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDF 2148
            ||:||||||||||||||||||||||||||||||||||||||||.|:|||..||||||||||||||
  Fly  2276 FQDARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGTLKRDDHSRPEDQVLMRALRDF 2340

  Fly  2149 NIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFA 2213
            |||||||:|||:||||||||||||||||||..|||..|:|:..::|||||:||::|:|||:||..
  Fly  2341 NIPKIVTEDVPIFMGLIGDLFPALDVPRKRVFEFEKTIRRAVNEIKLQPEEGFLMKVVQLQELLD 2405

  Fly  2214 VRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFS 2278
            |||||||:|.|||||:::|:||.:||:.||.||..:.|||||::||||||||||:||||||||||
  Fly  2406 VRHSVFIVGNAGTGKTKIWQTLRETYRIQKLKPVCHVLNPKALSNDELFGIVNPTTREWKDGLFS 2470

  Fly  2279 ILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLR 2343
            .:||:|||:....||||||||||||||||||||:|||||:|||||||||:|.:|||||||:..|:
  Fly  2471 SIMREQANMPPGNPKWIVLDGDIDPMWIESLNTLMDDNKILTLASNERISLKREMRLLFEVGHLK 2535

  Fly  2344 TATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTR-LRSI 2407
            .|||||||||||||||||||||:|::.|||.||.:..|..:||.||:||.|.|:.  |.| .|.|
  Fly  2536 AATPATVSRAGILYINPQDLGWSPYVSSWLETRVDMIERGILNALFEKYFPCLMQ--RQRDFRRI 2598

  Fly  2408 TPISDIARLQMTCYLLDSML--------------------TPQN-----VPNDCPKDWYEIYFVF 2447
            |||:|:|.:||||:||:.:|                    .|.:     :.::......|..||:
  Fly  2599 TPITDMAMIQMTCHLLECLLDSDEGNADGRGRGSATGGAANPHSLHHGELSHEAMVMALETIFVY 2663

  Fly  2448 CIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVP---- 2508
            ..||.|||:|.||.||||..||.||::.|:|.:|.|..||:|.:.::.:|.||.||:.|..    
  Fly  2664 ATVWSFGSALSQDVIIDWHREFHKWWIGEFKDIKLPSQGTVFDYQLNVQTLKFQPWSELAAHQSL 2728

  Fly  2509 QFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSD---- 2569
            :.::|.:.|||:.|::||||.||.:|:..||:.:...||:|.||.||..:.........:|    
  Fly  2729 EGQIDSETPLQNVLISTAETIRLAYFLKLLIDRNLACMLVGNSGCGKGAIFRQLFGQYANDQELL 2793

  Fly  2570 -----------------------------KYSVTNVP---------FNFYTTSEMLQRILEKPLE 2596
                                         |.|.:..|         |||||:||:.|::|::|||
  Fly  2794 EVAVSAATAGDSSHQQQSGNPAGAVVVRRKASSSATPLLTTVQATHFNFYTSSEIFQKMLDRPLE 2858

  Fly  2597 KKAGRNYGPIGNK-RMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNI 2660
            ||:||.|.|.|.| |:||||:|:||||||.|.||||||::||||||..|||||::.|:||..|..
  Fly  2859 KKSGRCYAPSGPKRRLIYFVNDLNMPEVDAYGTVQPHTIMRQFMDYRQWYDRQRLQLKDIRHCQF 2923

  Fly  2661 VACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMV 2725
            .|||||:|||||||||||||||.|:|.||.:|.|.||..||||.|:::|.|.|.|.:..:...:|
  Fly  2924 AACMNPTAGSFTIDPRLQRHFCVFSVAPPGEDTLHHIYGSILSSHLESPSQGFTKEIRSIGSLLV 2988

  Fly  2726 TTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYS---------------NSETCPNSNQ 2775
            ...|.||.:|..:|||||:||||.|||||:..|:.|::.|               ....|...::
  Fly  2989 RVGIALHRRVEYAFLPTALKFHYLFNLRDLTGIYQGLMNSVGAPASAGGGGASGFGGTICSRPSE 3053

  Fly  2776 MIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVYAQPLIYCHFAKGLTDIKY 2840
            ::||::||.:|||.|:|||..||.|||..:.||.:|..|..::|.|:|:||||.|||:.|.|.||
  Fly  3054 LMRLYVHEAFRVYHDRLVDPYDIKSFKSSIRDIFKKDFEDFDEDFVFAEPLIYSHFAQSLVDQKY 3118

  Fly  2841 MPISGWDRLKSLLDEAQDRYNDYIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQS 2905
            ||:..||.|..||.|||..||:.:|.||||||:|||.|||||:|||||.||.||||||||||||:
  Fly  3119 MPLKSWDSLYQLLIEAQASYNEVVGYMNLVLFEDAMIHVCRINRILESPRGNALLIGVGGSGKQT 3183

  Fly  2906 LTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVND 2970
            |.|||:|||||:|.|||:.:.:.:.|::..|..||||.|:|..|..||::|:::..|..|:|:||
  Fly  3184 LARLAAFISSLNVSQIQIKRGFGLLDMREEIGNLYMKVGLKNLASVFLISDAQIPDESILMLIND 3248

  Fly  2971 LLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLR 3035
            |||||:|.|||.||:::.|.|.:||||||.|.:|.:||||:||:||||.||||||||||||.|||
  Fly  3249 LLASGEIPELFNDDQLDTITNGIRNEVKQSGTLDTKENCWRYFVEKVRRLLKVVLCFSPVGQTLR 3313

  Fly  3036 VRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEIT-VLPKELALPVSNFMAFVHKTVNDISK 3099
            ||:|||||:::.|.||||||||:.||||||.:||:||. :|...|..|:..|||:||.|||.||:
  Fly  3314 VRARKFPAIISRTAIDWFHEWPKSALESVSQKFLNEINGILEPALVPPIGCFMAYVHGTVNQISR 3378

  Fly  3100 LYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKV 3164
            :||.|.|||||||||:|||.|.||.|||.:|.....:|..||::|:.|||.|.::||.|:..|.:
  Fly  3379 IYLQNEKRYNYTTPKTFLEYIFLYRKLLVDKNGEFAERIARLQSGMSKLAECARQVDTLKHQLAI 3443

  Fly  3165 QEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPAL 3229
            |||:|..||..||.||::|..|:|||.:||..||:|||.||.|||||:.|.|:||||..:|:|||
  Fly  3444 QEVQLAAKNAAADKLIVIVSAESEKVKRERYIASEEEKRVRIIEEDVSIKTKMCEEDLRQAEPAL 3508

  Fly  3230 IAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFL 3294
            :|||.||||||||||||||||||||.|||:||.||:||.:|.||||:||||||.:..|..||:||
  Fly  3509 VAAQAALNTLNKNNLTELKSFGSPPKAVVNVCAAVMVLLASNGKIPRDRSWKASKLMMVRVDQFL 3573

  Fly  3295 DNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKER 3359
            ::|:||:|.:|||::|:.||.|:.|.||:|:|::.||.||||||:||||::|::.|:|:|.||::
  Fly  3574 NDLLNYNKDNIHPNIIETLQEYLKDPEFNPDKVVQKSVAAAGLCAWVINLHRYHQVFLIVGPKQQ 3638

  Fly  3360 ALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLI 3424
            ||.:|.:|:.:||::|..|..::..||.:|..:|.|::.|:.:||:||.||.|||||||:|:||:
  Fly  3639 ALQDSHQELLEARERLQYLKAKINNLEAKLAEIQAEFENAVGEKQRCQREADKTAFTIDLAHRLV 3703

  Fly  3425 GGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPI 3489
            .|||.|.:||.|||:.|...|..||||||:||.|:||||||||.||:|||.|:|:|.|:...|.|
  Fly  3704 NGLANENVRWKESVQSLLAKIGTLPGDILLISSFLSYVGCFTRRYREELQHKMWLPNFRKIDPHI 3768

  Fly  3490 PSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYGT 3554
            |.|:|||...:..||||||.|||:|||.||||.|||.||..|.|:|||||||||||||:|.::||
  Fly  3769 PHTEGVDTLALFSDDAQIAAWNNEGLPMDRMSTENATILQYSTRWPLMIDPQLQGIKWIKNRFGT 3833

  Fly  3555 GLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTVLKIGDREIDFNS 3619
            .||||||.|:.:|:.:|:::|.|..:|||.|.|::|.||.|||.|.|||||..|:|||:||:|::
  Fly  3834 DLVVLRLRQKGFLEALEKSISQGDTVLIEQIEESMDTVLEPLLSRALIKKGRYLRIGDKEIEFHA 3898

  Fly  3620 RFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHF 3684
            .||||||||:|||||||||||||||||||||.||||:||||||||:||||||.|:|.:|.|||.|
  Fly  3899 SFRLILHTKMANPHYKPEMQAQTTLINFTVTPDGLEEQLLAEVVKIERPDLEQMKTEVTVQQNKF 3963

  Fly  3685 KITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRP 3749
            ||:||.|||:|||||:|:|:|||:|..||:|||.||:|.||||.||.||::|.:|||..|..||.
  Fly  3964 KISLKALEDELLARLASSGENVLDDHALVINLENTKRTVDEIEAKVREARVTTLQIDDTRNIYRS 4028

  Fly  3750 AAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYT 3814
            ||:||:|:||:|.||.:|||||:||||:|..||..|:..|..::..:.||.:|::|||..::.||
  Fly  4029 AAKRAAILYFVLTDLSRINPIYKFSLKSFMNVFRQAIAMAAESKNYEKRVLHLVESITLQTYRYT 4093

  Fly  3815 SRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNFTWLTHVGWGGIRALNNQ 3879
            .|||||.|||.|.:.:.::||:...:|...|.|||||||:.|...|...::....||||::|...
  Fly  4094 LRGLFEADKLTFTSHMTLRILIAAEQVAKDETDFLLRFPHDPTTLSPLDFVGRSAWGGIKSLTLI 4158

  Fly  3880 AVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGKSAIQRLCIMRCIRPDRMSYAMRSFIEE 3944
            ..|.|::||:|...|||:||:.|::||.|:||||||.::.:|:|||:|.:|||||:||||.|:|:
  Fly  4159 EHFYGIDKDMENYTKRWRKFMASDTPEREQFPGEWKHRTPLQKLCIIRSLRPDRMTYAMRQFVEQ 4223

  Fly  3945 KLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQG 4009
            .:|..|.:.::..|...|:|.:..|..||:|||||||::|||:.|:..||..:.:...::|||||
  Fly  4224 TMGRSYAEIQTPPFGAIFQELNAATPAFFILSPGVDPIRDVERYGQRQGFHSESDTLVNISLGQG 4288

  Fly  4010 QEIVAENAIEIASQYG-HWVILQNIHLVARWLPSLEKKME----SSLSNVHTSYRLFLSAEPAGD 4069
            ||::||.||..|.:.| .||||||||||..|||:|||.:|    .|.|...:::|||:|||||.|
  Fly  4289 QELLAEQAIIGALESGQQWVILQNIHLVVNWLPTLEKLIERIVLQSESKGESNFRLFISAEPAPD 4353

  Fly  4070 PAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVA 4134
            |..|::|||||||::|:.||||:||.||:|||.||||.:.||.|::|.|||:|||:|||||||..
  Fly  4354 PQYHVIPQGILESSLKVVNEPPSGMAANLHKAWDNFSQDALETCTQEAEFKSILFALCYFHAVAG 4418

  Fly  4135 ERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLC 4199
            |||||||||||:.||||:||||||..||:||||.:.|:|||||||||||||||||||||||||||
  Fly  4419 ERRKFGPQGWNKVYPFNIGDLTISSNVLHNYLEGSNRIPWEDLRYLFGEIMYGGHITDDWDRRLC 4483

  Fly  4200 RTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVS 4264
            :|||||.:|.:||||:.|.|.|||||..|.:.|||:||.:.||.|||.|||||.|||||||||.|
  Fly  4484 QTYLEELLQQDLIDGDFELCPGFPAPPNLDFEGYHSYITEMLPEESPLLYGLHPNAEIGFLTTAS 4548

  Fly  4265 ERLFRIVFELQPRMTGGSS--GGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVEDRSPYIIV 4327
            |:|.|.:||||||.:..||  |   ..:|:::|.:|:|.|||....||:..|:.|||.::|:::|
  Fly  4549 EQLLRTIFELQPRESELSSHCG---APREELVKIMIDDFLDKLQDEFNLQALLNRVERKTPFVVV 4610

  Fly  4328 AFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQS 4392
            |.|||||||.|:.|:||||.||.|||:|||||:..||.|...::.|.||..|.:|||||||||||
  Fly  4611 ALQECERMNALIREIKRSLRELMLGLRGELTITQEMERLDHAIFYDHVPAAWARLAYPSMLGLQS 4675

  Fly  4393 WFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKW 4457
            ||:||:.|::||.||:.||::|.:|||.|.|||||.||||||::|||::.|||||.::||||||.
  Fly  4676 WFADLLHRIKELAGWLNDFKLPCAIWLGGLFNPQSFLTAIMQESARKHDLPLDRMLISCDVTKKQ 4740

  Fly  4458 KEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECP 4522
            |:::|..|.|||:::.|:|:||.||.::.:|.....||:..||||:|||::.|:||:::.|||||
  Fly  4741 KDDVTLPPMEGAFVHDLYMDGASWDCQLNSIVALRPKEMLCAMPVIYIKSIVQEKQELQRVYECP 4805

  Fly  4523 VYKIRLRGPTFVWTFNLKSRERASKWTLAGVCLLLQ 4558
            :||.|.||.|:|||||||:|||.|:|.|.||.||||
  Fly  4806 LYKTRSRGNTYVWTFNLKTRERPSRWILGGVALLLQ 4841

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 152/634 (24%)
DHC_N2 1368..1770 CDD:285579 206/410 (50%)
P-loop_NTPase 1903..2132 CDD:304359 194/229 (85%)
P-loop_NTPase 2217..2352 CDD:304359 99/135 (73%)
P-loop_NTPase 2510..2783 CDD:304359 142/331 (43%)
P-loop_NTPase 2860..3127 CDD:304359 171/268 (64%)
MT 3140..3480 CDD:289543 197/340 (58%)
AAA_9 3509..3722 CDD:289547 147/213 (69%)
Dynein_heavy 3864..4549 CDD:281078 401/692 (58%)
CG3339NP_001036762.2 DHC_N1 276..903 CDD:285571 152/638 (24%)
DHC_N2 1535..1944 CDD:285579 206/410 (50%)
P-loop_NTPase 2095..2324 CDD:304359 194/229 (85%)
P-loop_NTPase 2409..2544 CDD:304359 99/135 (73%)
P-loop_NTPase 2731..3061 CDD:304359 142/330 (43%)
P-loop_NTPase 3138..3406 CDD:304359 171/268 (64%)
MT 3419..3759 CDD:289543 197/340 (58%)
AAA_9 3789..4001 CDD:289547 147/212 (69%)
Dynein_heavy 4142..4832 CDD:281078 401/693 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C354692116
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1463at33208
OrthoFinder 1 1.000 FOG0000061
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.