DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dhc93AB

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001262793.1 Gene:Dhc93AB FlyBaseID:FBgn0013812 Length:4496 Species:Drosophila melanogaster

Alignment Length:4594 Identity:2456/4595 (53%)
Similarity:3235/4595 (70%) Gaps:162/4595 (4%)


  Fly    12 DNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGGQLYPSYSFPV 76
            |.|.|...:::.|:::||.:|||:::|..|.:.:|.|||:......:|..:....||.||.:||:
  Fly    19 DPRLELMGSFVIKSLKLKPEKWTRVVTVEEHKGIIKEFLDRNTPVVLIIILTPAAQLVPSTTFPL 83

  Fly    77 -RPRYKVAYFI-RYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFPLLNNTVNQVGWTN 139
             :.:.|..||| ||..|  :..|:..|.::.|||....:..||.|.:||..|||:|..|...|..
  Fly    84 SQLKSKGVYFIKRYALP--IPREDCGNFIIYGDLATRTIDQLSALVEEVLVPLLSNEDNYRNWPI 146

  Fly   140 VIANDMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDISVVNPLMKHSLEFM 204
            ::|.|::.....:::.:.|:||.|...||..:|:.::::::||..:...:....:..:|.::|.:
  Fly   147 MVAQDVQKHVHSLKSTVHQVKGQVSGETILAMPVGVEKIVKAAKELVETEQCQFDLYLKSAIEGV 211

  Fly   205 VVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIKTIGFVLEKI 269
            |:||...:.:::.........:.:| |.|...|:||.:||:||..:.:||.:.||:.:..:||..
  Fly   212 VIKWATQIHEVIKESPSNAFANGQN-PTPHTEFTFWNNRLKNLSFIYDQLRNERIRAMALILEYS 275

  Fly   270 QSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLMLTIGLVWGHS 334
            .|.:...::.:.:.|:.:||||:|||..|:||||.:...|..|..|.:..:.|.|.|:|::||:|
  Fly   276 MSAYHPCFQTLFKNVVTALAEAKDITLYLNPLKRPLQHLEEIDFAECKPLLIPFMNTVGILWGNS 340

  Fly   335 RYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINMQHLEYYKLIYNECRNS 399
            ||:.....:|:......|.:|....|.::|.|||..|:|||.::|.:::|.|::::.:::     
  Fly   341 RYYCQSAKITVLLQEICNLIIHQAKRYLDPSSIFHSDIDEAMQRLTLSIQILKFFRELFD----- 400

  Fly   400 LKKFKIGTTFNSQD------WTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKLEKIVMGGLKG 458
            ..|.::.|.|...:      ||:|.:.:|.|.:.||.||..::..|.||.:|.||||:.:|||:|
  Fly   401 YYKERLATFFTEPEERPPILWTFHPNSVFKRFNAFLERLTTIQWFFFTVIEFLKLEKVEIGGLRG 465

  Fly   459 RQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTDVMERMVSFQFEKGLE 523
            ||::..:..:..|:|..:..:.:..|:.:|||...  |..|...|:.:...::..::....:..:
  Fly   466 RQLSTRITDVYVEFNQYFTAFASKSYDVLDPDDHE--FDEDFKGFQTRILELDMKLAAILCQAFD 528

  Fly   524 DTHDL-------LLAGSLLLRPIIKKHVEPLMHVIVDDFEEEIMCVKKEFINFKNVFTALGLNEL 581
            |.|:|       .:.||:|.||.||:........||...::| |.:.:...:.:.....:|.|..
  Fly   529 DCHNLESIFKLISIVGSVLDRPKIKEEFTQRYAEIVRMLDDE-MTICESIYDKQMELKKVGDNLY 592

  Fly   582 PTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLL 646
            |..:| |.|:..|.:..:|..||....|..:..::.:...|:...:.:.:.|::.::........
  Fly   593 PNYNC-PPVAAFIRWCHQLETRITAPVKNFKALQHEITKTEKSQEIVERYEILMVKLGSCKTQFF 656

  Fly   647 DKWTVECWQGIQQDITLTLIEKDEA-NELRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCRE 710
            |.|..:....|::::..:||.:|.. |.|.:||:..|...|:::..::.:..:....:...|..:
  Fly   657 DDWAGQLDGQIEENLKKSLIARDRRHNSLILNFSAALFSILREVHYMQQMKIEGIPQIAIDFAEK 721

  Fly   711 DELWQA-RVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFS-QRFIVMI 773
            .::::: .:.|.:..:|||...|.:.|.|.|||..|:.:|::.::..::.:.||:.. ..::..:
  Fly   722 SDVFRSYTLNLEKTIDWYNSIQEGSSPVELRLIEPEIKMIDDLVEIGVNQLVWNSSDILSYLDKL 786

  Fly   774 FKMVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQ 838
            .|.|..|.:|:...|.||..|::.:..|.|.|||:|:|.....:|..|.|....|.|.|......
  Fly   787 RKPVAALQNRMDHTQGNLRQIRKIMGVWAKQPLFERRDCKKDTVLSIDERPDRTSKRYAEIQAAS 851

  Fly   839 RLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDD 903
            ..|..|:..|: |.||:             |.::.|.:|                          
  Fly   852 IEIHKLLQDNM-LQFDM-------------ESKQDDAVW-------------------------- 876

  Fly   904 LEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYL--R 966
                                       ||         |..:||.|:.||::.:|..|..||  .
  Fly   877 ---------------------------LS---------YVDFVDNIVYENILKTVGVSVGYLAEN 905

  Fly   967 MEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPT 1031
            |:.:|.|   .|:||..:||.|||:|:..:||.....||...:..::.|:..|.||:||:  .|.
  Fly   906 MDPENNY---APLFESRLELVEPNLVFVPSLDPEDPMGFNNMLIELMRDIMKMGSLIKRL--KPN 965

  Fly  1032 EVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKK 1096
            |..|     :.:.:::..::...|.||:|.:.|.::......:.|..:|.||:.|:...:....:
  Fly   966 EKRN-----YVEMIKENQDIIDMRREILNGVDLVMEEASRFCRQFERYSYLWLDDREECMEYFLE 1025

  Fly  1097 FGRNLTLDERDAEADLEGSSGVKLLGLE----------YPPLSVYKEQLDKFIELQDQIRTWETY 1151
            :||.|..||            ::|:.:.          .|.:..::||:|.:..|.::|.....:
  Fly  1026 YGRMLDPDE------------IELILINDPNQPPPQPCQPTIEAFREQIDNYESLFNEIEDIGPF 1078

  Fly  1152 EDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFE 1216
            :.|..:.::::..|:.|:|:.|.:|.::||..|:..|.:||..|..|:.:|:..|...:::.|:|
  Fly  1079 QVFSSWFQVDVRPFRQALLNTVCKWGNMFKEHLVTTVTSSLMNLSHFIRKADEGLLQTVKEKDYE 1143

  Fly  1217 GLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATT 1281
            |||.|::.|.|:.|:....|.||:|::|.|.||:.|:.:..:.....:.|||:.|...|::|:|.
  Fly  1144 GLVSIMAYLMQVKERAAKTDEMFEPMQETIQLLKYYDMDIPEEVNVLLQELPEQWANTKKIASTV 1208

  Fly  1282 KQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQR 1346
            ||.::|:|:.:|..|..:|.|.::....:|:.|.:..||...|...|.|:|..:.::...|...|
  Fly  1209 KQQVSPLQATEVVSIRNKIALFESHIQLFREVFKTYDFFRFDCYKPYLLMDRINDDMFLCESEMR 1273

  Fly  1347 SLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKK 1411
            .:.||..|||:..|:...::.||.:|:::|.:||:...:.::|:|||.|||:|:|:||||.||||
  Fly  1274 DIQESGSLFEVNIPEFKVLKQCRKELRMLKQLWDYVNIVATSIDDWKTTPWRKVDVENMDIECKK 1338

  Fly  1412 FGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTK--------- 1467
            |.:::|.|||.||.|:.||.:|:::||::||||||.||||||||:|||.:||.:||         
  Fly  1339 FAKDIRLLDKEMRPWDTFINLESTVKNMLTSLRAVGELQNPAIRERHWNQLMNSTKSLAALPKEV 1403

  Fly  1468 -VKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTS 1531
             |||.||..|||.:|:.|||||.||||||||||:||||:|||.|||:.|.|..|||..::|.||.
  Fly  1404 TVKFIMDHETTLAELLGLNLHECEEEVKNIVDKAVKEMSMEKILRDLNTTWTVMEFDHELHPRTG 1468

  Fly  1532 IKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLE 1596
            ..||||||||||||||:|..|||:.:|||||.|..||..|||:|..|||:|..||||||.|.:||
  Fly  1469 CNLLKASEELIETLEDNQVCLQNLITSKYIAHFLEEVSTWQNKLMIADQVITVWFEVQRTWTHLE 1533

  Fly  1597 SIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLC 1661
            |||:.|||||.|||.||.|||.||.||:.|:.:|:...|||.||||||  |.|.||.|.|.|.||
  Fly  1534 SIFMSSEDIRKQLPVDSDRFDNIDAEFRVLMDEMSVSSNVVASTNRSG--LIERLEHLQKELTLC 1596

  Fly  1662 EKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLISGSKN---- 1722
            ||||.:|||||||::|||||||||||||:||||..|.:|.:|||||:||:.:|.......|    
  Fly  1597 EKALAEYLETKRLAFPRFYFVSSADLLDVLSNGIQPEMVTKHLTKLFDSIARLKFNRDESNEINT 1661

  Fly  1723 AAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPA 1787
            |:||.||: .|||.|.|.....|.||||||||...||.:||..:..::..|:.|.|..|:|::||
  Fly  1662 ASGMYAKD-GEYVEFNELASIRGPVEVWLNRIQAAMRASLRHYVMEAVIAYEEKQREQWLFDYPA 1725

  Fly  1788 QPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICT 1852
            |.:|.|:||.|:||.|.||:::::.|:||:|||.||||:||:.||.||||:|:..:|||||||||
  Fly  1726 QVSLCGSQIWWSTEVNIAFSRLEEGYDNAIKDYYKKQISQLSLLITLLLGELSKGDRQKIMTICT 1790

  Fly  1853 IDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVIT 1917
            |||||||||..:|..|::..:||.||||||||:|....|||||||||:|:|.:||||||||||||
  Fly  1791 IDVHSRDVVAKMIQAKLDSGSAFMWQSQLRHRFDDVEKDCFANICDAEFQYCHEYLGNTPRLVIT 1855

  Fly  1918 PLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKG 1982
            ||||||||||||||||||||||||||||||||||||||||:|:.||||||||||||:|.|:|:||
  Fly  1856 PLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRAIGISVYVFNCSEQMDYQSCGNIYKG 1920

  Fly  1983 LAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGY 2047
            ||||||||||||||||:||||||||||||.:||||:.||..|:|:||.|:...|||:||||||||
  Fly  1921 LAQTGAWGCFDEFNRITVEVLSVVAVQVKSVQDAIRDKKDKFNFMGEMISCVPTVGIFITMNPGY 1985

  Fly  2048 AGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYD 2112
            |||.|||||||||:||||||||||.||.||||||||||:||:|||||||||||||||||||||||
  Fly  1986 AGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFQDARVLARKFITLYTLCKELLSKQDHYD 2050

  Fly  2113 WGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRK 2177
            ||||||||||||||:|:|.|..|||::||||||||||||||:|||:|||||||.|||||||||||
  Fly  2051 WGLRAIKSVLVVAGSLKRGDPGRPEEEVLMRALRDFNIPKIITDDMPVFMGLISDLFPALDVPRK 2115

  Fly  2178 RNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQ 2242
            |:.:||..:|::|.||.|||||.||||:||||||..|||||||:|.|||||::|||||.:||||.
  Fly  2116 RDQDFERTVKQAASDLLLQPEDNFILKVVQLEELLEVRHSVFIVGNAGTGKTQVWKTLLRTYQNI 2180

  Fly  2243 KRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIE 2307
            ||||.:||||||||||||||||:||:||||||||||:|||||||:.|..||||||||||||||||
  Fly  2181 KRKPIFNDLNPKAVTNDELFGIINPATREWKDGLFSVLMRDQANITGDQPKWIVLDGDIDPMWIE 2245

  Fly  2308 SLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSW 2372
            |||||||||||||||||||||||..|||||||::||||||||||||||||||||||||.|::.||
  Fly  2246 SLNTVMDDNKVLTLASNERIALTPSMRLLFEISNLRTATPATVSRAGILYINPQDLGWNPYVTSW 2310

  Fly  2373 LGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDCP 2437
            :.||...:|.|.|.:|||||:||.|:..|.|.:.|||::::|.:||.|:||:..|.|.|.|.|||
  Fly  2311 VETRKIPAEKSNLVMLFDKYIPPSLETIRVRFKKITPVAEMAHIQMLCHLLNCFLIPANTPADCP 2375

  Fly  2438 KDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFP 2502
            |:|:|:||||..:|.|||::||||.||:..|||||::||:|.||||..||:|.:::|.|||.|.|
  Fly  2376 KEWHELYFVFACIWAFGSAMFQDQAIDYRVEFSKWWVNEFKTVKFPPGGTVFDYFLDSETKTFLP 2440

  Fly  2503 WTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALP 2567
            ||..:|:||||.|||||:.:|:|:|:.|||||:|.|::..||:||:|.:|.|||:|:|.||.:| 
  Fly  2441 WTEKIPKFELDSDLPLQAVIVHTSESIRLRFFLDLLMDKKHPVMLVGNAGCGKTVLVNEKLQSL- 2504

  Fly  2568 SDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPH 2632
            |:.|:||.:|||:||||||||:||||||||||||||||.|||.:.|||||:||||||.|.|||||
  Fly  2505 SENYAVTTIPFNYYTTSEMLQKILEKPLEKKAGRNYGPPGNKLLCYFVDDINMPEVDAYGTVQPH 2569

  Fly  2633 TLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHI 2697
            ||:||.:||.|||||.|:||:|||.|..||||||::|||||:||||||||..||:.|..:::..:
  Fly  2570 TLMRQHLDYGHWYDRNKLTLKDIHNCQYVACMNPTSGSFTINPRLQRHFCVLAVSFPGPESITVM 2634

  Fly  2698 LNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGV 2762
            .:|||:||..|..|||...|.::..|:|...|.||.|.:..|||||||.||.||||||:|:|.|:
  Fly  2635 YSSILAQHFANAEQKFTPIVTRMTPNIVAATIALHNKCLQVFLPTAIKSHYIFNLRDISNVFQGL 2699

  Fly  2763 LYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVYAQPLI 2827
            |:|::|....|..:||||.||..|||.|||.|..||:||.|:..|||:|..|.:::.|::.:|.|
  Fly  2700 LFSSTECLTGSTDLIRLWQHETQRVYSDKLTDDKDIDSFTKMQHDIVKKSFEEIDESVIFDKPNI 2764

  Fly  2828 YCHFAKGLTDIKYMPISGWDRLKSLLDEAQDRYNDYIGAMNLVLFDDAMSHVCRISRILESSRGY 2892
            |||||.|:.|.|||||.||..|..||.||...|||.:.|||||||:|||.|||||:|||||.||.
  Fly  2765 YCHFAGGIGDPKYMPIKGWPELHKLLQEAMSSYNDLVAAMNLVLFEDAMMHVCRINRILESPRGS 2829

  Fly  2893 ALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDS 2957
            |||:||||||||||.|||:|||||:|.||||.|.|.|:|||...:.||:|||:|.....|||||:
  Fly  2830 ALLVGVGGSGKQSLARLAAFISSLEVVQIQLKKGYGVNDLKNEFSGLYLKAGLKNVGIMFLMTDA 2894

  Fly  2958 EVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLK 3022
            ::..|.||||:||:||:|:|.:||||||:|||:..||||||..|:||.||||||:||::||..||
  Fly  2895 QIPSEDFLVLINDMLATGEIPDLFPDDEIENIIAGVRNEVKGAGLVDTRENCWKFFIDRVRKQLK 2959

  Fly  3023 VVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFM 3087
            :||||||||:|||||||||||::|.|:|:|||||||:||.||::.||::..|||:.....|:.||
  Fly  2960 IVLCFSPVGSTLRVRSRKFPAIINATSINWFHEWPQEALISVAMNFLAQNKVLPENHRDSVAKFM 3024

  Fly  3088 AFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCT 3152
            |:||.:||..||:||.|.:|||||||||:||.|.||.|||:.|.:....:..||||||.||.|..
  Fly  3025 AYVHTSVNTTSKVYLQNERRYNYTTPKSYLEQINLYIKLLNHKNEDLQSKIERLENGLEKLRSTA 3089

  Fly  3153 KEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKL 3217
            .:|..|:..|.|||:|||.||:.||.||.:||.|.|||..|:|.|.:||..|..|.::|:.|.:.
  Fly  3090 LQVADLKVKLAVQEIELKEKNEAADALIEIVGIETEKVQTEKAVADEEEMKVALIADEVSKKQRD 3154

  Fly  3218 CEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKA 3282
            ||||.|||:|||:|||:|||||||.||||||||||||.||.:|..||:||.|..||:||||||||
  Fly  3155 CEEDLLKAEPALMAAQDALNTLNKANLTELKSFGSPPGAVTNVTAAVMVLLSQGGKVPKDRSWKA 3219

  Fly  3283 CRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRF 3347
            .:..|..||.|||:||||||::|||::.||:|||:.|.||.||.:.:||.||||||:|||||.:|
  Fly  3220 AKIAMAKVDTFLDSLINYDKENIHPEITKAIQPYLKDPEFEPEFVRSKSGAAAGLCAWVINIIKF 3284

  Fly  3348 YDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASK 3412
            |:||..||||.:||..:..|:..|:|||..:..::..|||||..|..::::|.|.|.:||.||..
  Fly  3285 YEVYCDVEPKRKALAAANAELAAAQDKLAGIKRKVMSLEEQLGKLTADFEKATADKLRCQQEADA 3349

  Fly  3413 TAFTIDIANRLIGGLATEKIRWMESV-KVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEK 3476
            |..||.:||||:||||:|.:||.|:| ..:..|| .||||||:|:.|||||||||:.:|.:|..|
  Fly  3350 TQATIALANRLVGGLASENVRWAEAVNNFVKQGI-TLPGDILLITAFISYVGCFTKGFRIDLLLK 3413

  Fly  3477 LWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQ 3541
            :|.|..|:..||||:|:.:||..::.||..||.|.|:||||||||.|||.||..|:|:|||||||
  Fly  3414 MWTPFLKSIDPPIPTTENLDPLSLLTDDTTIAIWTNEGLPSDRMSIENATILSNSDRWPLMIDPQ 3478

  Fly  3542 LQGIKWVKTKYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGT 3606
            |||:||:|.|||..|.|:||.||:|||.:|::::.|..:|||||.||:||||:.||||.|||||.
  Fly  3479 LQGVKWIKQKYGEDLKVIRLGQRSYLDIIEKSINAGCNVLIENIDENLDPVLDSLLGRNLIKKGK 3543

  Fly  3607 VLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLE 3671
            .:||||:||::||.||||||||||||||||||||||||||||||||||||||||||||.||||||
  Fly  3544 AIKIGDKEIEYNSNFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKAERPDLE 3608

  Fly  3672 AMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKIT 3736
            .::..||:|||.|||.||.||||||:||||||:|:|.|..||.|||.||.||.|||.||||||||
  Fly  3609 ELKADLTKQQNDFKIMLKKLEDDLLSRLSSAGENILGDTALVENLETTKSTASEIEQKVAEAKIT 3673

  Fly  3737 GVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVEN 3801
            ..:||.|||.|||||.|||::|||||:|..||||||||||||:|||..|:.||...:.|..||.|
  Fly  3674 SKEIDKAREYYRPAAARASLLYFILNELNTINPIYQFSLKAFSVVFQKAIAKAEPGDTLDLRVSN 3738

  Fly  3802 LIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNFTWLT 3866
            |||.||:..|.||||||||.|||||.:|:..|||:...||...|||||||||..|:.||...:||
  Fly  3739 LIDCITYSVFQYTSRGLFECDKLIFASQMTFQILLMNEEVTSAELDFLLRFPIKPHVTSPVDFLT 3803

  Fly  3867 HVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGKSAIQRLCIMRCIRP 3931
            :..||||.:|.::..|:.|::|||.|.|||||.|:||.||.||||.|||.|:|:||||::|.:||
  Fly  3804 NQSWGGICSLASKDEFRNLDRDIETSSKRWKKLVESELPEKEKFPQEWKNKTALQRLCMIRALRP 3868

  Fly  3932 DRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSF 3996
            |||:||:..||||||||||:::|:|||::::||:||.|.|||:|||||:||||||.|||.:|||.
  Fly  3869 DRMTYALADFIEEKLGSKYVESRAMEFAKSYEEASPSTPIFFILSPGVNPLKDVEALGKQMGFSM 3933

  Fly  3997 DHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSLSNVHTSYRLF 4061
            |..|||:||||||||.:||.|::.|:::||||:|||||||.:|||.||||:|....:.|..||:|
  Fly  3934 DLGNFHNVSLGQGQEAIAEAAMDTAAKHGHWVVLQNIHLVRKWLPVLEKKLEYYAEDSHPDYRMF 3998

  Fly  4062 LSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSL 4126
            ||||||..|:|||:|||||||:|||||||||||:||:|||||||:.|||||..||.|||||||||
  Fly  3999 LSAEPASTPSAHIIPQGILESSIKITNEPPTGMLANLHKALDNFTQETLEMSGKEAEFKAILFSL 4063

  Fly  4127 CYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHIT 4191
            |||||||||||||||||||:.||||||||.|||.|||||||||.:||||||||||||||||||||
  Fly  4064 CYFHAVVAERRKFGPQGWNKIYPFNVGDLNISVSVLYNYLEANAKVPWEDLRYLFGEIMYGGHIT 4128

  Fly  4192 DDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAE 4256
            ||||||||.|||||:|||:|:||||.....||||....|.|||.|:|:.:|:|||.|||||.|||
  Fly  4129 DDWDRRLCITYLEEYMQPDLVDGELFLAPSFPAPPNTDYQGYHTYVDEMMPAESPYLYGLHPNAE 4193

  Fly  4257 IGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVEDR 4321
            ||||||.:|.:||.|||:||| ..|:.||.||::||.:|.|:::|::|.|..||::|:|.:||:|
  Fly  4194 IGFLTTRAENIFRTVFEMQPR-DAGAGGGATVTREDKVKQIVDEIIEKLPEEFNMVEIMNKVEER 4257

  Fly  4322 SPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPS 4386
            :||:|||||||||||.|.:|:||||.||||||||||||:|.||.|...|::||||..||:.||||
  Fly  4258 TPYVIVAFQECERMNFLTSEMKRSLKELDLGLKGELTITSDMEVLENSLFLDQVPPIWTQRAYPS 4322

  Fly  4387 MLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNC 4451
            :|||.:||.||.|||||||.|..||.:||.:|||||||||||||||||.|||:|:.|||:|||.|
  Fly  4323 LLGLNNWFIDLCLRLRELETWSTDFVLPSCVWLAGFFNPQSLLTAIMQSTARRNDLPLDKMCLQC 4387

  Fly  4452 DVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIK 4516
            |||||.|||.|||||:|..::|:||||||||::.|.|.::.||||:|:|||:.|:|:||||||::
  Fly  4388 DVTKKQKEEFTTAPRDGCCVHGIFMEGARWDIQQGIIMESRLKELYPSMPVINIRAITQDKQDLR 4452

  Fly  4517 NVYECPVYKIRLRGP-TFVWTFNLKSRERASKWTLAGVCLLLQT 4559
            |:|||||||.|.||| |:|...|||::::..||.||||.|||||
  Fly  4453 NMYECPVYKTRTRGPTTYVSNLNLKTKDKPGKWILAGVALLLQT 4496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 150/581 (26%)
DHC_N2 1368..1770 CDD:285579 244/416 (59%)
P-loop_NTPase 1903..2132 CDD:304359 196/229 (86%)
P-loop_NTPase 2217..2352 CDD:304359 115/135 (85%)
P-loop_NTPase 2510..2783 CDD:304359 167/273 (61%)
P-loop_NTPase 2860..3127 CDD:304359 176/267 (66%)
MT 3140..3480 CDD:289543 193/341 (57%)
AAA_9 3509..3722 CDD:289547 154/213 (72%)
Dynein_heavy 3864..4549 CDD:281078 464/686 (68%)
Dhc93ABNP_001262793.1 DHC_N1 204..782 CDD:285571 151/588 (26%)
DHC_N2 1295..1708 CDD:285579 244/416 (59%)
P-loop_NTPase 1841..2071 CDD:304359 197/230 (86%)
P-loop_NTPase 2155..2290 CDD:304359 115/135 (85%)
P-loop_NTPase 2448..2720 CDD:304359 167/273 (61%)
P-loop_NTPase 2797..3064 CDD:304359 176/267 (66%)
MT 3076..3419 CDD:289543 194/344 (56%)
AAA_9 3447..3659 CDD:289547 154/212 (73%)
Dynein_heavy 3799..4486 CDD:281078 464/688 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C354692160
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1463at33208
OrthoFinder 1 1.000 FOG0000061
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.