DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and CG9492

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001287256.1 Gene:CG9492 FlyBaseID:FBgn0037726 Length:4724 Species:Drosophila melanogaster

Alignment Length:4957 Identity:1402/4958 (28%)
Similarity:2334/4958 (47%) Gaps:682/4958 (14%)


  Fly     3 DEKEKKEPVDNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIE-FLNNPNKKRIIF------ 60
            :.|.::..:|.|.||.:..|....:|...:....|...:..|.|.: ||.|...|.:.|      
  Fly    43 ERKARRGEMDPRLEFTFQLLIDATQLPRHQLMDYIFEGDMLDEINQLFLPNMKNKLLWFYQETDD 107

  Fly    61 -------------TINSG----------GQLYPSYSFPVRPRYK---------------VAYFIR 87
                         ...||          |...||...|  |::|               ..|..|
  Fly   108 PEPTPVPDPNKPGPSRSGVASSSSKTPQGGASPSGMPP--PKHKKLFLTDGWTCAFTGVCIYIFR 170

  Fly    88 YLTPLHLTDENMLNSLLIGDLLPNPL---ANLSILCDEVF-----FPLLNNTVNQVGWTNVIAND 144
            ..|...|.:|.....|..|.:....:   .::..:.:.||     ||.|......|. ..:|...
  Fly   171 VNTSKQLPEEGFQKDLYCGVIDAKNIGLVTSIERIVEFVFMQALAFPSLEGDEEDVS-CGLIKGQ 234

  Fly   145 MKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDISVVNPLMKHSLEFMVVKWL 209
            :....:...:.:...:.:..:..:|.....|.|.:.|...:.  |:| .|......||..|..|.
  Fly   235 LLPGLRSFCSALRVCEQVCDHHNVFADGCDMFEKIDAVEEVK--DMS-KNQEFCAQLEERVNNWT 296

  Fly   210 DSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIKTIGFVL-------E 267
            ..:  |..:...|::..:.:...|:....:|:.|......|...|.|:.::   |.|       .
  Fly   297 KGI--LKILGESEQLRKENDHSGPQDELEYWKKRGAQFSQLLAHLQDKEVQ---FTLHCLFLAGS 356

  Fly   268 KIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLMLTIGLVWG 332
            :|...::.:.|:|.    ....||||.:|.:..::........:|....:..|..|:.|:.|::.
  Fly   357 RIIKQWKETDRKIT----FCYNEARDNSKFIQAMETCCHSLYLDDPVSMKESILSLLQTVRLIYS 417

  Fly   333 HSRYFHTLNNMTLFFNLFHNSLIDCVNRTVE---PDSIFQGDVDEAYKKLD--INMQHLEYYKLI 392
            .|::::|....:.......|.:|:.....:.   .::|:..|.:....||.  |.:.|      |
  Fly   418 VSQFYNTSERTSALMVKITNQMIETCKSYITCRCKETIWSQDRNVIRTKLSNCIKLNH------I 476

  Fly   393 YNECRNSLKKFKIGTTF--NSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKL-EKIVMG 454
            |:|...::::    ..|  |...:.:.::.:||:.|.|..||.::..:||.:.|:..| |:.:.|
  Fly   477 YHETYYTVRE----QPFLPNQTPFGFSENFVFGKFDTFCERLSKIISMFNLIDDYNHLFERRLEG 537

  Fly   455 GLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTDVMERMVSFQFE 519
            .|.|.    |||.....:....:|.|:.:|:.:  |..||.|..|...|..||:.::..::...|
  Fly   538 LLLGE----ALEDASNHFEEAKKEVTSRKYDYL--DHRNSDFNIDFERFIHKTNSLKDTIATLIE 596

  Fly   520 KGLEDTHDLLLAGSLLLR--------PIIK---KHVEPLMHVIVDDFEEEIMCVKKEFINFKNVF 573
            |..:...:.......|:|        |:.:   |:...|.:|     |:|:..:.|.|...:   
  Fly   597 KDFDTVWETPQCIRFLVRFEKVSEKIPLTRMDEKYTRILRYV-----EKEVDRILKTFRKQR--- 653

  Fly   574 TALGLNELPTDDCFPKVSGAISFLKKLRHRIIGLH---KEH-ELYEYPLFDNERGGYVSDIFNIM 634
                 ::.|....||.::|.|.:.:.|...|..|.   .|| .|...|:..:....| .::..|:
  Fly   654 -----DDPPLARNFPPIAGRIHWCRALSLHITELMDAVMEHVVLSSLPMAKDLDVRY-HNVLGIL 712

  Fly   635 VQEIDDFTKMLLDKWTVECWQGIQQDITLT---LIE---KDEANELRVNFTERLIFALKDIKVVR 693
            .:..|:...:.||           ||:::.   |::   ..:.::|.||....:...:::.|::.
  Fly   713 QEYEDEIVSIWLD-----------QDVSVADACLLQPLLSLQGDKLFVNLHPTIPLLIREAKMLA 766

  Fly   694 LLGCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLD 758
            .|..::.:.......|:......:..|..:.:.:..|........:.|...:::.:...:||.|.
  Fly   767 KLDIELPIVAATLMSRQQYFITIQDSLNCLIKMFLSTVRAVKLEVRPLFLPQLVRLTAMLKPGLH 831

  Fly   759 FI-----KWNAFSQR-------FIVMIFKM-----VKYLH----------------DRLVAAQEN 790
            .|     .|..|.:|       |.|::.::     .:.||                |.:....|.
  Fly   832 TINWTNQNWTEFYERCKQAIESFDVLVARVHDIYSNRILHVLMWMQDVSLQILPADDEIWTVDEF 896

  Fly   791 LEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILS-IRAANAADTQRLIDLLMYVNLKLFFD 854
            ||..:|:.|   |..:    :||....:.::..|.:|| :..|.||..:...|     ::...||
  Fly   897 LERSEEACR---KAAI----ELNRKSQMVSEAVEEVLSLVDRATAAFKEIAGD-----DVITLFD 949

  Fly   855 IPRRYSLPPGEH----GEEDEESDG------------------------IWP----PIISLSVMT 887
            .    :.|.|::    |.:.|:..|                        :|.    |:..||...
  Fly   950 A----ATPKGDNSGSGGRKPEDGGGGGGGAAAPSTSGGGGGGQQQDWSILWSCFENPLSLLSTTE 1010

  Fly   888 SVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAE 952
            |                                      |.||:.........|...|....:.:
  Fly  1011 S--------------------------------------LPKGMQDMVCNAVVEMRRYYSRKVID 1037

  Fly   953 NLVDSVITSSTYLRMEVDNRY---ENNT----PIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIE 1010
            .|:..:..:...||    .|:   ||.|    |:|.:..:||.|:||...|||.           
  Fly  1038 VLIKVIRAALDTLR----RRFIADENETVFKKPVFALHAQLQIPHVVIKPNLDE----------- 1087

  Fly  1011 TILDDM-----NNMMSLLKRVAQ-----DPTEVT---------NMN------------------- 1037
              |.|:     .|:..:.|.|||     ||.:|:         |.|                   
  Fly  1088 --LQDILVTAGKNITGIAKGVAQWSSGKDPPQVSMTVQPRVGRNHNESTGGGKSRRRKIYCLASE 1150

  Fly  1038 -----PY---SFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEV 1094
                 |:   |||..:.|..|:.|...::.:..|.....::.:.|.:..:..||..|::|  .::
  Fly  1151 ERPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPYHFLWKNDRTT--RQL 1213

  Fly  1095 KKFGRNLTLDE--------RDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETY 1151
            .:||    |.|        .|.:|:|.....:::.|   ..::||.|:| |:             
  Fly  1214 MEFG----LQEFETTLRCLSDLDANLLVEPDMEVFG---QCVAVYNEKL-KY------------- 1257

  Fly  1152 EDFFVFLRLNMTGFKVAVLS---QVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKD 1213
                        |..:.:.|   ::||           .:|...|:..|:|  ..::.:::.:.|
  Fly  1258 ------------GLAIEIKSCNHKIGQ-----------AMKKKYKKEMDYV--YAVINEMDRKLD 1297

  Fly  1214 ----DFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKV 1274
                |.:.:..|:..|.:|.|::...:...||::|..::|.:|..:   .|..|.:       .|
  Fly  1298 RPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQ---VEREQFD-------LV 1352

  Fly  1275 KRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFV-------PCLSCYELID 1332
            ..|.||.:.|:|.....||.|::.:....|:: .|....|...|..:|       |..:.....:
  Fly  1353 DNLRATFQNLLAGALQAQVKLLDMQPAFQDDL-RTNLDNFKQDKISYVTEYRTAGPMQAGLTPRE 1416

  Fly  1333 ESDLELVALE-------ERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTIN 1390
            .|| .|:..:       .|.::......||.|...|..::...|.:|.|::.::.....:...::
  Fly  1417 ASD-RLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVS 1480

  Fly  1391 DWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIR 1455
            .:...||.::|||.::.|..:|....|.|.|.::.|..|..::.::.:.......:..:.|.|::
  Fly  1481 SYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMK 1545

  Fly  1456 DRHWIELMQTTKVKFSMD-DSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGT 1519
            .|||..:|..|:..|..| :..:||::::..|.:::|::::|...::||..:|.:|:.:...|..
  Fly  1546 PRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSV 1610

  Fly  1520 MEFGTDIHDRTSIKLLK--ASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQII 1582
            .|......:.....||:  .:.|.|..|||....|.::.|::|.|.|..:::.|...|||:::|:
  Fly  1611 HELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEIL 1675

  Fly  1583 GSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSG--S 1645
            ..|..||..|.|||::|:|. ||..|||::::||..|||.::.::.:.:....||.......  .
  Fly  1676 ERWLLVQNMWVYLEAVFVGG-DIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLK 1739

  Fly  1646 KLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDS 1710
            :|..||:   :.|.:|:|:|:.|||.||:.:|||:|||...||:||...::...:..||..::|:
  Fly  1740 QLLPHLQ---EQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDN 1801

  Fly  1711 MGKLNLISGSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRS------ 1769
            ...:.......|....:.....|.:.........|.||.||.::....:.:|...::.:      
  Fly  1802 TKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATIND 1866

  Fly  1770 -----LTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLN 1829
                 |:|.:         :.|||..|:|.|::||.:...|..:.::|  ..:.:.|.|.:..||
  Fly  1867 PNFTLLSFLE---------KAPAQIGLLGIQMVWTRDAEMALMRGRER--KVMMETNNKFLEMLN 1920

  Fly  1830 NLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFA 1894
            .||.....:||..||....|:.||.||.||:...:....::....|:|..|.|..:...:|..:.
  Fly  1921 TLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWI 1985

  Fly  1895 NICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALG 1959
            ::.|..|.|..||||.|.|||||||||||||||.|:|.|.|||||.||||||||||.||:|:.|.
  Fly  1986 SVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLA 2050

  Fly  1960 MMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTF 2024
            ..|.|||||:||||:.:|.|:|||||:|:||||||||||.:.||||.|.||..:..|.|.|::||
  Fly  2051 KYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTF 2115

  Fly  2025 SFL-GEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEAR 2088
            .|. |:.|.:....|:|||||||||||.|||||||..:|..||:|||..:|..:.|.:.||.|..
  Fly  2116 LFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENI 2180

  Fly  2089 LLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKI 2153
            .|||||.|||.||:|.|:||.|||:|||.|.|||...||.:|.:.:..|..::||.|||.|:.|:
  Fly  2181 TLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKL 2245

  Fly  2154 VTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSV 2218
            :.||.|:||.|:.||||...:.:...||.||.|.:...:..|.....::||::||.|...|||.:
  Fly  2246 IDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGI 2310

  Fly  2219 FIIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRD 2283
            ..:|.:|.||:....||.|.............:||||:|..::||.::.:|.:|.||:||.|.|.
  Fly  2311 MTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRK 2375

  Fly  2284 QANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPA 2348
            ...|......|:||||.:|.:|||:||:|:||||.||||:.:|:.:...::::||..::..|:||
  Fly  2376 TLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPA 2440

  Fly  2349 TVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSI---TPI 2410
            ||||.|::|::...|...|.:|:||..|. ..|.|..:.|||:   ..::::...::.:   .|:
  Fly  2441 TVSRNGMVYMSSSGLDSRPIVQAWLKNRA-PGEKSTFSDLFDQ---TFVEVYNWGVQMVKLQMPV 2501

  Fly  2411 SDIARLQMTCYLLDSML-----------------------------------------TPQNVP- 2433
            .....:|...::|:.::                                         ..:::| 
  Fly  2502 LQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDLPP 2566

  Fly  2434 --------NDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPL------ 2484
                    :.|..:.....::|.:.||.|..|         :...:..:|.:....||.      
  Fly  2567 ETSIEEKEDTCTPEHLHRLYIFALAWGLGGYL---------STSDRQRMNLFVKESFPQLDYPKG 2622

  Fly  2485 ---SGTIFSFYIDHETKKFFPWTNLV-PQFELDMDLP-LQSNLVNTAETTRLRFFMDTLIEADHP 2544
               ..|||.|::. ....:..|..|| |....::..| ..|.||...:..|:.:.:.|:...:..
  Fly  2623 SAHENTIFDFFVS-PAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERA 2686

  Fly  2545 LMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNK 2609
            :|:||..|:|||::|...:..:..:.|...:..|:..|:....||.:|..:||:.|..:||.|.:
  Fly  2687 VMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGR 2751

  Fly  2610 RMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQK----MTLRDIHKCNIVACMN-PSAG 2669
            ::|.|:||:|:||::::.....:.::||.||...:|..:|    .|:.|:   ..||.|. |..|
  Fly  2752 KLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDV---QYVAAMGLPGGG 2813

  Fly  2670 SFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHL- 2733
            ...|..||:|.||.|..|.|..|::..|...|...|. |..:.|...:..|.:.::  .:|.|| 
  Fly  2814 RNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHY-NAKRGFVPEIRSLVKKLI--VVTRHLW 2875

  Fly  2734 -KVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTD 2797
             :.....|||..||||.|:|||::.|:.|::.:.|....:.:.::.||.|||.||:.|:...:.|
  Fly  2876 QRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQD 2940

  Fly  2798 INSFKKIVSDIVRKGIEGVNDDVVYAQPLIYCHFAKGL----------TDIK----YMPISGWDR 2848
            ...|...::.:||:.:...:..::...| ::..|.:..          ||::    |.|:...:.
  Fly  2941 KEWFGSELACLVREELGDSHSQMILPNP-VFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEV 3004

  Fly  2849 LKSLLDEAQDRYNDYI--GAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLAS 2911
            |:..|.....::|:.:  ..|:||.|.|||.|:.:||||:...||..:|:|||||||||||:|||
  Fly  3005 LRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLAS 3069

  Fly  2912 FISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGD 2976
            ||:....|||.||:.|:|::...::..||...||:.....||.||.::..|.||..:|::|:||.
  Fly  3070 FIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGV 3134

  Fly  2977 IHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWK---------YFIEKVRSLLKVVLCFSPVGA 3032
            |..||..||...|       |::|..|..|||..|         :|:.:..:.|.|..||||||.
  Fly  3135 ISNLFSRDEQAEI-------VQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGE 3192

  Fly  3033 TLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLS--EITVLP---KELALPVSNFMAFVHK 3092
            |.|.|.::|||||:..||||.|.||:.||.||:..|||  ||...|   :||.    |.:..:..
  Fly  3193 TFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELV----NALGSIQD 3253

  Fly  3093 TVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDA 3157
            .|.:.|:.|....:|..:.||||:|..||.|..:...|.:...|...:::.||.||...:..|:.
  Fly  3254 IVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEI 3318

  Fly  3158 LQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEED--------VTAK 3214
            |:..|.|.|.||...::.|:::::.|        .|||..::..||...|.:|        :..:
  Fly  3319 LKKDLVVMEEELVEASKNAESVLVEV--------TERAMQAEIVKNQVLIVKDKAEALVACIAHE 3375

  Fly  3215 AKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSK-------- 3271
            ..|.||....|:|||..|:.||||:...::..::..|.||..::.:...||:||..|        
  Fly  3376 KALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDA 3440

  Fly  3272 -GKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAA 3335
             ...||. ||:.....|.:. .||..|.||.|..|:.::|..||||....:::.:.........|
  Fly  3441 GTPCPKP-SWQESLKMMASA-TFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVA 3503

  Fly  3336 GLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEAL 3400
            ||.||...::.|:.|...|.|.:..|...|..:|.|.|.|.....:|.|.||.|.|::.:||:|:
  Fly  3504 GLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAV 3568

  Fly  3401 AKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCF 3465
            .:||:..|.|:.....:..|..||.||:.||.||....|.....:.:|.||:|:.:.|:||.|.:
  Fly  3569 GEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPY 3633

  Fly  3466 TRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQ 3530
            .:.:|..| .|.||...|  |..||.|.|::...|:.|.:.::||..||||:|.:|.:||.|..:
  Fly  3634 NQEFRANL-IKTWMGILK--QKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATK 3695

  Fly  3531 SERYPLMIDPQLQGIKWVKTKYGTG-LVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLN 3594
            |..|||::|||.||..|:|.|.... |.:..|:.:.:...:|.::|.|..||||::|.::|||::
  Fly  3696 SSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVID 3760

  Fly  3595 PLLGRQLIKKGTVLK--IGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQ 3657
            .:|.:..||.|::.|  :||:|.|....|.|.:.|||.||.:.||:.|:|::|:||||..|||||
  Fly  3761 NVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQ 3825

  Fly  3658 LLAEVVKVERPDLEAMRTRL--TQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTK 3720
            ||..|:.:|:.||||.|..|  |..||  :..:|.||.:||.||||:..::::|..|:..|..||
  Fly  3826 LLGRVILMEKSDLEAERVALFETVMQN--QRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTK 3888

  Fly  3721 KTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNA 3785
            .||:|:..|:..:::|..:|..|||.:|..|:|.||:||::.::..:|.:||.|||.|.|:||::
  Fly  3889 TTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHS 3953

  Fly  3786 MLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTE----- 3845
            :.|:..:...::|:..::..:|:..:.:|:|.|:|:.|.:|...|.|:|..:.|.:...|     
  Fly  3954 ITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFI 4018

  Fly  3846 -----LDFLLRFPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESP 3905
                 ||.....|      ..|.|:..:.|..:..::....|..:.:.||.:.|.|:.:.:.|.|
  Fly  4019 KGGASLDLNAVTP------KPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKP 4077

  Fly  3906 ENEKFPGEWKGKSAI----QRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESS 3966
            |||:.|   .|.:||    ::|.::|...|||.....:.:|||.||.:|.:.:.::....:.||.
  Fly  4078 ENEEIP---CGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESE 4139

  Fly  3967 PETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQ 4031
            |.|....:||.|.||...:..|.|.....     ..|||:|||||..|...|..:...|.||:||
  Fly  4140 PRTPFVCLLSIGSDPTTQIGALAKQKSIV-----LKSVSMGQGQEYHARKMIIESMAIGGWVLLQ 4199

  Fly  4032 NIHLVARWLPSLEKKMESSLSNVH--TSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGM 4094
            |:||.   ||...:.::..:.:.|  .|:|::::.||..:     .|.|:|:.|:|.|||||.|:
  Fly  4200 NVHLS---LPFCSEIIDMLVESEHIDDSFRMWVTTEPHNE-----FPIGLLQMALKFTNEPPQGI 4256

  Fly  4095 MANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISV 4159
            .|::.::..:|:.:.|:..| .|::..:|:::.:.|.:|.|||||||.|||..|.||..|...||
  Fly  4257 RASLKRSYQSFTQDFLDYTS-ATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASV 4320

  Fly  4160 YVLYNYL---EANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQG 4221
            ..:.|:|   :....|.|:.|.|:.||:.|||.:|||:|:||..|:...:....|:....|:.:|
  Fly  4321 QFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKG 4385

  Fly  4222 FPAPGILKYTGYHNYIDDNLPS-ESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGG 4285
            :..||.....|:.:|| ::||: ::|.::||||||:|.:....::.:...:..:||: .||..||
  Fly  4386 YKVPGTKSLQGFIDYI-NSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPK-EGGGGGG 4448

  Fly  4286 ETVSQEDIIKNIIEDILDKTPTPFNILEL---MGRVEDRSPYIIVAFQECERMNNLMTELKRSLN 4347
            ||  :|.|:..:.:|:|.|.|..:|..|:   :.|:....|..|...||.:||..::..:...|.
  Fly  4449 ET--RESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLC 4511

  Fly  4348 ELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPS-MLGLQSWFSDLMLRLRELEGWVADF 4411
            :|.|.:.|.:.:|..:::.:..:|..::||.|.|:::.| .||.  |:::|:.|..:...|::..
  Fly  4512 DLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGF--WYTELLERNGQFRTWISTD 4574

  Fly  4412 RMPSSIWLAGFFNPQSLLTAIMQQTARKNE-WPLDRMCLNCDVTKKWKEELTTAPREGAYINGLF 4475
            | |...|:.||||||..|||:.|:..|.:: |.||.:.|...:|:..||::|..|.||.|::|||
  Fly  4575 R-PKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLF 4638

  Fly  4476 MEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGP-TFVWTFNL 4539
            :|||..|.:.|.:.::.:|.|:..|||:||.|:.........:||||:|:...|.. .:|.:.:.
  Fly  4639 LEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTTAGKDPKLYECPIYRKPQRTDLKYVGSIDF 4703

  Fly  4540 KSRERASKWTLAGVCLL 4556
            ::......|||.||.||
  Fly  4704 ETEFNPKHWTLRGVALL 4720

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 116/607 (19%)
DHC_N2 1368..1770 CDD:285579 106/418 (25%)
P-loop_NTPase 1903..2132 CDD:304359 143/230 (62%)
P-loop_NTPase 2217..2352 CDD:304359 52/135 (39%)
P-loop_NTPase 2510..2783 CDD:304359 82/281 (29%)
P-loop_NTPase 2860..3127 CDD:304359 116/283 (41%)
MT 3140..3480 CDD:289543 108/357 (30%)
AAA_9 3509..3722 CDD:289547 93/218 (43%)
Dynein_heavy 3864..4549 CDD:281078 224/701 (32%)
CG9492NP_001287256.1 DHC_N1 283..843 CDD:285571 116/610 (19%)
DYN1 1178..4372 CDD:227570 1053/3339 (32%)
DHC_N2 1458..1861 CDD:285579 106/407 (26%)
P-loop_NTPase 1994..2222 CDD:304359 142/228 (62%)
P-loop_NTPase 2309..2444 CDD:304359 52/135 (39%)
P-loop_NTPase 2662..2926 CDD:304359 81/270 (30%)
P-loop_NTPase 3025..3287 CDD:304359 115/273 (42%)
MT 3300..3646 CDD:289543 107/357 (30%)
AAA_9 3674..3890 CDD:289547 93/218 (43%)
Dynein_heavy 4031..4713 CDD:281078 226/712 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93447804
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.