DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and CG14651

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_649475.3 Gene:CG14651 FlyBaseID:FBgn0037254 Length:1079 Species:Drosophila melanogaster

Alignment Length:1326 Identity:243/1327 (18%)
Similarity:451/1327 (34%) Gaps:487/1327 (37%)


  Fly   207 KWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLG-DRRIKTIGFVLEKIQ 270
            :||..:         :|:.....||||..:....::|.....:|.:.:. |||.:.    .:||.
  Fly    80 RWLTLM---------DKMGKAHRFPLPTILPKVIQTRYVPKRHLPKDVEVDRRRRQ----YQKIN 131

  Fly   271 SIFEHSYRRIVELVLESLAEARDI-TKCLSPLKRKMDKFETNDMDENRSDIRPLMLTIGLVWGHS 334
            .:.|.:...:.:.||:...|..:: ::...|.|..:..|:.::.|                    
  Fly   132 LVNELAKAGLTDDVLQPTEEQYNVMSEFAFPHKFPLSYFDDSNFD-------------------- 176

  Fly   335 RYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINMQHLEYYKLIYNECRNS 399
                 :|:...:|.|                    |.|.:|:..|... .:|.|.:.:.| |:..
  Fly   177 -----INSPAAWFEL--------------------GVVGDAHYPLPAK-AYLPYNQSLLN-CQWG 214

  Fly   400 LKKFKIGTTFNSQD---WTWHQDEIFGRLDKFLVRLEE--------LKDLF---NTVRDFQKLEK 450
            :    ...|.:.:|   ||             |:.||:        |:.:|   :..:..::|:.
  Fly   215 M----AAVTAHHEDSDLWT-------------LLSLEDGCTYTVPKLQFMFMAEDPHKYIKRLQA 262

  Fly   451 IVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTDVME-RMV 514
            .|....||.|: ..:|.|::   .:..|           |.|:::|    .|||....|:: ..|
  Fly   263 AVHERHKGEQL-MLMELIVD---CVLHE-----------DIESTVF----YSFKPIESVLQAAKV 308

  Fly   515 SFQFEKGLEDTHDLLLAGSLLLRPIIKKHVEPLMHVIVDDFEEEIMCVKKEFINFKNVFTALGLN 579
            |.|.::.|....:|:.              |.||.:.  :.|:.|:.:.|||..|:|:    .|.
  Fly   309 SEQCKRRLRSEVNLVF--------------ERLMALY--ELEQFILKMPKEFPQFRNI----NLK 353

  Fly   580 ELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKM 644
            |.........|||.    ::|..:.:|:..:.:.|:|         ..:.:| ..|..|:....:
  Fly   354 EFLPRSFAVDVSGK----ERLELQALGITMQEKRYDY---------LKASLF-YCVGGIEAMAGV 404

  Fly   645 LLDKWTVECWQGIQQDITLTL--------------IEKDEANE------LRVNFTERLIFALKDI 689
                 .:|| |.|:   ||::              ::..||:.      |:|.:.::|...:  .
  Fly   405 -----AIEC-QYIE---TLSIFICSFSKPLALVDFLQAQEAHSDNVATFLKVYWPQQLTTVI--T 458

  Fly   690 KVVRLLG---CDVSVNL---------------TKFFCREDELWQARVKLMRIA------------ 724
            .|:|.||   .|:|:|.               .||..:|.........||..:            
  Fly   459 VVLRALGKGWLDISLNTWTVYLMCKISRFILQVKFRMQESMEVLLETSLMNFSHFVCDPCLQFLE 523

  Fly   725 -----EWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFSQRF---IVMIFKMVKYLH 781
                 :|.|:..:...|.:|.:.|..:.:.|::.      :.::.....|   :|.|||      
  Fly   524 LKSNYKWTNNYIDTEFPFQKPVFAMTLGISEDRK------VFYSTDPDEFQPGLVEIFK------ 576

  Fly   782 DRLVAAQENLEAIKESIRSWGK---------VPLFQRKDLNPALLLHTDPREPILSIRAANAADT 837
             :.:.....:..|..|:.|:.|         |.|.:.:.|....||.....:.:|.:| |.|...
  Fly   577 -KCLEKSSGVRCIDGSVMSFLKFAPNLYILTVELIEDRFLRENELLKNCYAKAVLPLR-AYARLY 639

  Fly   838 QRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEED 902
            :|.||..: :|:..:.....:...|..|                           .||::::.  
  Fly   640 ERFIDFYL-LNVNTYMQAYAQAHKPSSE---------------------------VKRDILEN-- 674

  Fly   903 DLEEFEEEQSESEEEIIT--PFH-RYELLKGLSQEER--ALFREYEIYVDEIIAENLVDSVITSS 962
              :..:||..|.....||  ||: ..:.:|....::|  .:.|.:|.|||.:             
  Fly   675 --KRLKEELREILPAFITIGPFYINVDTMKQFMIKKRIEVVRRIFEYYVDRM------------- 724

  Fly   963 TYLRMEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVA 1027
                      ||.|                                 |.:||   ..:.:.:|:|
  Fly   725 ----------YETN---------------------------------EVLLD---RCLEMFRRIA 743

  Fly  1028 QDPTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSL---------- 1082
            :.|..:.::  |...|..|...:|       ::::|..:|.:      ::|:..|          
  Fly   744 ERPISIEHL--YEIRDFAQTVPDL-------VDELKADIQVM------WLEYDLLDSFFYNLSDH 793

  Fly  1083 ----------WIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDK 1137
                      |.......||.:|        ||:  :.|:|     ..|.|.......::|:|: 
  Fly   794 QFAMKWNVYAWPHQIMVRLSTLK--------DEQ--KVDIE-----DFLRLHASECQAFEERLE- 842

  Fly  1138 FIELQDQI----------RTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSL 1192
              .|.|::          |..||..|      :..|...:..|.:|.|.:. |:.:|......|:
  Fly   843 --SLNDEVQAYSLAFNTNRAQETSVD------IKKTWALIKELEKVSQTLQ-FRQELFELEPLSV 898

  Fly  1193 KELQDFV-------------------DEA---NIVLKIELQKDDFEGLVKILSVLNQ----INEK 1231
            :.|:..:                   ::|   |.:.:::|: |.:..|:::...||:    .:||
  Fly   899 EFLESIIASFTPYKNLWYGCANFLKLEDATLGNPIAQLDLE-DVWNNLMRLRDELNESMKIFHEK 962

  Fly  1232 QCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKV--KRLAATTKQLI--APIQSYQ 1292
            ..|.|.....:.:|.|.:..|| ..||..    ||   .||.:  :.|:|.|.|.|  :...:||
  Fly   963 VEIMDVAKTFIAKIDDFVPVYN-SIKDIR----NE---NWMYIHWQELSAITGQEIKYSVAMNYQ 1019

  Fly  1293 VDLIEKRIL-----------LCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQR 1346
            . ||.|.||           ..:|.|...|:                 .|:|        |||::
  Fly  1020 Y-LIRKGILDVLPEVHIISEKANNEAEEIRR-----------------AIEE--------EERRK 1058

  Fly  1347 SLAESAVLFELQGPDPVKIELCRFDL 1372
            ....:|:|...|      :..||.|:
  Fly  1059 QAELNAMLLRKQ------LRKCRRDI 1078

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 113/628 (18%)
DHC_N2 1368..1770 CDD:285579 3/6 (50%)
P-loop_NTPase 1903..2132 CDD:304359
P-loop_NTPase 2217..2352 CDD:304359
P-loop_NTPase 2510..2783 CDD:304359
P-loop_NTPase 2860..3127 CDD:304359
MT 3140..3480 CDD:289543
AAA_9 3509..3722 CDD:289547
Dynein_heavy 3864..4549 CDD:281078
CG14651NP_649475.3 DHC_N2 904..>1042 CDD:285579 33/148 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92349695
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.