DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah3

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_647937.2 Gene:Dnah3 FlyBaseID:FBgn0035581 Length:4385 Species:Drosophila melanogaster

Alignment Length:4669 Identity:1303/4670 (28%)
Similarity:2133/4670 (46%) Gaps:792/4670 (17%)


  Fly   346 FFNL---FHNSLIDCVNRTV-EPDSIFQGD--VDEAYKKLDINMQHLEYYKLIYNEC-RNSLKKF 403
            |:||   |....:|.|...: |..|..|.|  |....::.|.:...|:..|..|:|| .:||::.
  Fly    50 FYNLTYGFDQLPLDPVKEFLQEKISHMQTDKIVGHCNREFDFHRYDLDNVKDEYDECDDDSLQEL 114

  Fly   404 KIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKD-LFN----TVRDFQKLEKIVMGGLKGRQITF 463
            ::            :|.|   :.:....|.:.|| |:|    ....|..::|.:.|.....|..:
  Fly   115 QL------------EDII---MPEQFEMLRDAKDHLYNFDSTACNQFPWIDKWMTGVRPSEQEIY 164

  Fly   464 AL-EKILEEY---------------NSIYREWTN---IQY-NPID-------PDAENSLFQRDRL 501
            .: ..:||.|               :|:   |||   .|: :|.:       |.|.:  .:.:.:
  Fly   165 EMTSHLLEIYCNRRVRIFYPGCGTSSSL---WTNQLRRQHGSPSELIGAYRTPSARH--MRVNNM 224

  Fly   502 SFKAKTDVMERMVSFQFEKGLEDTHDLLLAGSL---LLRPIIKKHVEPLMH-------------- 549
            ....|.:.......:.|....|..::|:..|.:   |:.|::|.....:.|              
  Fly   225 RGPPKKEKFTAGDHYAFRTPQECRNELMRVGKIIDELIEPVLKAAEHKIGHGLTKYPDPPSCKDN 289

  Fly   550 ---------VIV---------------DDF---EEEIMCVKK-EFINFKNVFTALGLNELPTDDC 586
                     ::|               .||   ||.:.|:|: |..:|..:   ..|..:..|| 
  Fly   290 TNRILRSAGILVGKKKNCYVGKCRIHRKDFATNEEFLRCLKRMEATHFPYM---QPLQPVDPDD- 350

  Fly   587 FPKVSGAISFLKKLRHRI--------IGLHKEH----------ELYEYPLF--------DNERGG 625
                 ..|..|.|.|..:        :.:.|.:          :|..||..        .|.|..
  Fly   351 -----QKIKMLAKYRVELARAEKLFTLKIQKRYQCLLKSMSIVQLATYPSHLIRKAFRRINPRSA 410

  Fly   626 YVSDIFNIMVQEIDDFTKM-----LLDKWTVECWQGIQQDITLTLI------EKDEANELRVNFT 679
            .:.|.:..:|:|..|:.|:     |:|...|.. :|::||:.:.:|      ::|..:.::.:|.
  Fly   411 LLQDAYQFIVKEKRDWPKLPPEVILMDYLFVGD-RGVRQDLAILIIVCLIDLQEDFRHYVKRSFL 474

  Fly   680 ERLIFALKDIKVVRL-----------LGCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFER 733
            ..|:.:..:.:.::|           :...||             |  |..|:|......:....
  Fly   475 NYLLSSNMERRRLQLEREPPEFPILTISPPVS-------------W--RSNLLRGKARIGEVLMT 524

  Fly   734 AHPTEK-------------------RLIAAE--------MILIEEQMKPLLDFI----------- 760
            .|||.:                   :|:.|:        .:.||:....:.|.:           
  Fly   525 THPTVQALNRLWHDLYEDLVVVDLGQLLLAQRPLDADTVQVFIEKSCADVRDLLLNDWLPRCADL 589

  Fly   761 ------KW----------------------NAFSQRFIVMIFKMVKYLHDRLVAAQENLEAIKES 797
                  .|                      :|.|:....:|.|.:.||...|.|.:......|.|
  Fly   590 MNEMRGTWKDLVPMSGKYGGRAAMLFRCIHSAMSRHLNSLISKSINYLFKVLCAFKGGNRIEKYS 654

  Fly   798 I--RSWGKVPLFQRKDLNPALLLHTDPREPI---LSIRAANAADTQRLIDLLMYVNLKLFFDIPR 857
            :  ....::||...  :...:..|.| .|||   ..:|.|:              |:.::     
  Fly   655 MFDAKLKRIPLMTL--IASVVGAHFD-HEPINMGPGVRPAS--------------NIYVY----- 697

  Fly   858 RYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPF 922
                       :::::|....|.::..|          |.:.:.||:.:||.:  .|.:..|.|:
  Fly   698 -----------DEDDADPFQQPQVNQFV----------ENVPDIDDVAQFELD--HSNKLYIYPY 739

  Fly   923 HRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFEIFMELQ 987
                     .||...:|.|   :...|:|..                   ||  .|..|..|...
  Fly   740 ---------MQELPRIFTE---HFKSILAVG-------------------YE--IPRLEFVMSGG 771

  Fly   988 EPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMN----------PYSFY 1042
            ||..           .||..||:   :|..:.:.|.::|.|    :..:|          .|.:|
  Fly   772 EPET-----------KGFLHFID---EDHVDFLELCEKVEQ----IVKVNWQGVHVYLKPVYKYY 818

  Fly  1043 DELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERD 1107
            ..|..               ||.|..|:.            :|.::           ||      
  Fly   819 FGLFQ---------------KLILPMVQK------------VWTEN-----------NL------ 839

  Fly  1108 AEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETY--EDFFVFLRLNMTGFKVAVL 1170
                              |.|...:|.|.|...:.|     .||  .||..              
  Fly   840 ------------------PELGAVQELLKKLQAVSD-----TTYYLRDFIP-------------- 867

  Fly  1171 SQVGQWISLFKLDLINR-VKNSL----KELQDFVDE--------ANIVLKIELQKDDF------E 1216
                  ::||.||  || ||.||    :|:.||:.:        .|..:..||::...      |
  Fly   868 ------LNLFMLD--NRHVKLSLRMYVREIYDFIIDFYKALNWNENRAICEELEEMSMKAGERPE 924

  Fly  1217 GLVKILSVLNQINEKQ-----CIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINE----LPDAWM 1272
            ...:::::.|.||:.:     .|.|.:.:.||.::.||   .:.:..::...:|.    ||....
  Fly   925 ETPEVVALQNYINDCREMRIFAIKDEIKNVLKRVVFLL---THTYLSSDELHLNSRTFILPGELE 986

  Fly  1273 KVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKK--FLSKKFFFVPCL-SCYELIDES 1334
            :|..|:|.  :|.....:.::.|.|:|:.....:|...|..  |..::...|..| ...|.:|..
  Fly   987 EVLDLSAA--RLAVVRDNLELALRERRMEFEKLLAQEKRTMDGFRIREIRDVLTLEELKERVDTV 1049

  Fly  1335 DLELVALEERQRSL----AESAVLFELQGPDPVKIELCRFDL--------KLVKIMWDFAITIQS 1387
            ||....:|...|..    .|..:|         :|::..|.|        :.::.:|..:...:.
  Fly  1050 DLLFTTIENLSREAKAINTEETLL---------QIDVSAFPLLAEIIEKMEPIEKLWKTSYEFEK 1105

  Fly  1388 TINDWKKTPWKKID-------IENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRA 1445
            ....|....::.::       :|||.:...|..|:|.....|.|..|.   |...::.....|..
  Fly  1106 DYLIWMFERFECLNADGVREQVENMHKIMYKLSRQLAYNPVAKRAAEQ---MRMKIEKFRVYLPV 1167

  Fly  1446 VTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQL 1510
            :..:....:..|||.::.:....|.:.....||||:||:::.....:::.|.:.:.||..:...|
  Fly  1168 LDSICRHGLEKRHWDQISKILGRKVNPKLFPTLKDMIDVDIMSILPQLEEIANAAGKEYDLNNGL 1232

  Fly  1511 RDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRL 1575
            |.:...|..:.|....:..:...:|.:.:::...|:||..:.|.|..|.:|.....:...|:.||
  Fly  1233 RIMQADWRDVMFEVLQYRDSDTHILASLDDIQTLLDDHIMRTQAMKRSPFITALGSKADDWEARL 1297

  Fly  1576 SNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRST 1640
            .....||.:|.:||..|.|||.|| .||||..|:|.:.|.|..:||.::.::.....||:|:.:|
  Fly  1298 LLIQNIIDAWTQVQITWMYLEPIF-SSEDIMRQMPLEGRNFKAVDKLWRKIMKHTLKDRHVMAAT 1361

  Fly  1641 NRSGSKLYEHLEILLKMLLLCE---KALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVAR 1702
                 :..|.||:..|.:...|   |.||.|||.|||.:.||:|:|:.:||:|||...:|..|..
  Fly  1362 -----EYPEMLEVFTKAIEDLETVTKGLNTYLEQKRLFFARFFFLSNDELLEILSETKDPMRVQP 1421

  Fly  1703 HLTKLYDSMGKLNLISGSKNAAGMVAKELEEYVPFLENCD---CSGKVEVWLNRITDKMRDTLRD 1764
            ||.|.::.:|.|. ...:.....||:.| ||.|..:...:   .:|.||:||..:...|.|::::
  Fly  1422 HLRKCFEGIGSLT-FDDNMEIVEMVSDE-EERVALVRKINPQLANGLVEMWLKEVEMVMLDSVKE 1484

  Fly  1765 QLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIM-WTTETNDAFAKVQQRYENALKDYNKKQITQL 1828
            |::.:...|....|..|:..||.| .:.|...| ||.|..:|....:      |..|.:|...|:
  Fly  1485 QMREAWEDYAMVERISWVVSWPGQ-VVQGISCMAWTYEVEEAIETKE------LPAYLEKSNLQI 1542

  Fly  1829 NNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRW--DPKIDD 1891
            .:|:.|:..||.|..|..:..:..:|||.||||..:...::.....|.|.||||:.|  :.|.:|
  Fly  1543 ADLVQLVRTDLQAGVRIAVEALIVLDVHDRDVVKYLTDCRITNIQDFDWISQLRYYWKVNEKNED 1607

  Fly  1892 --CFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDL 1954
              |.:.:. ....|..|||||.||||:||||||||.||..:|.|.:||||.||||||||||.|||
  Fly  1608 WVCVSMVV-TDVEYGMEYLGNLPRLVVTPLTDRCYRTLMGALKLCLGGAPEGPAGTGKTETCKDL 1671

  Fly  1955 GRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKS 2019
            .:|:.....|||||:.:|||::|...|||||:|||.||||||||.:|||||||.|:..||.||..
  Fly  1672 AKAVAKKCVVFNCSDGLDYKALGKFFKGLAQSGAWACFDEFNRIELEVLSVVAQQILTIQRAIGR 1736

  Fly  2020 KKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGF 2084
            |...|.|....:.|..|..:|||||||||||.|||:|||.|:|..||:|||:|:|.||.|.:.||
  Fly  1737 KVVKFFFEDTMLKLDPTCSIFITMNPGYAGRTELPDNLKVLFRTVAMMVPDYAMIGEITLYSNGF 1801

  Fly  2085 QEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFN 2149
            ..||.|::|.:..|.||.|.||.|.|||:|:||:||||:.:.:|||.....||.::::||:.|.|
  Fly  1802 DMARNLSQKIVQAYKLCSEQLSSQSHYDYGMRAVKSVLLASASLRRLYVDLPEPEIVLRAIVDVN 1866

  Fly  2150 IPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAV 2214
            :||.:..|:.:|:|:..||||.:::|..:..:....:..:..|..||....::.||:|:.|:..|
  Fly  1867 LPKFLEQDISLFIGIYMDLFPGVELPMPQRGDILKWLHINLADRNLQATPWYLEKILQIYEMLLV 1931

  Fly  2215 RHSVFIIGFAGTGKSEVWKTLNKTYQN--------QKRKP-HYNDLNPKAVTNDELFGIVNPSTR 2270
            ||.:.|:|.:..||:..::.|.:|.:|        .|..| .:..:||||:|..:|:|..:|.:.
  Fly  1932 RHGLMIVGGSMGGKTTAYQVLAQTLRNVSTDEEATLKEFPVTFRIINPKAITMGQLYGRFDPVSH 1996

  Fly  2271 EWKDGLFSILMRDQANLGGTGPK----WIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTK 2331
            ||.||:.:...|:|..    |||    |::.||.:|.:|||:||||:||||.|.|.|.|.:.:||
  Fly  1997 EWYDGVLAKTFREQVQ----GPKGERAWVMFDGPVDAVWIENLNTVLDDNKKLCLMSGEIMQMTK 2057

  Fly  2332 EMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNS---SEVSMLNVLFDK-- 2391
            .|.::||.|.|..|:||||||.|::|:.|..|||....:|::....|.   .::.|  .||:.  
  Fly  2058 LMNMMFEPADLEQASPATVSRCGMIYMEPSQLGWRALHKSFINVLVNKVGLGDIYM--TLFEDMT 2120

  Fly  2392 --YVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFG 2454
              .||..|: |..:.:.:..:|.|.:.|.........|......|..   |::..|:||..|.:.
  Fly  2121 EWLVPAALE-FLPQCKQMLELSPIYQYQTFSRFFLHFLEKHKQFNQA---WFQQMFLFCFAWAYC 2181

  Fly  2455 SSLF-QDQ---------IIDWSNE-FSK---WFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWTN 2505
            |:|. |.|         :|..||| |.|   :.||  :...|| ...:|..|...|.:.::.|..
  Fly  2182 SALTGQGQKTFDALLRKVIYGSNENFPKPKYFSLN--RGQMFP-EKLLFLDYRFDEAENWWTWQK 2243

  Fly  2506 LVPQFELDMDLP----LQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSAL 2566
            .........:.|    :...:|.|.||..:.::.:..|...:.::::||:|:||:.::.:.|.|:
  Fly  2244 SDDSASTTSNFPENAQISELIVPTKETGYISYWQEFCISKSYAMLVVGPTGTGKSAIITSNLLAM 2308

  Fly  2567 PSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQP 2631
            |.....|..:.|:..|:::|:|..:...|:::....:||...|:...|.||:.||..|.|.:..|
  Fly  2309 PKFANLVNVINFSARTSAQMVQDTIMSKLDRRRKGVFGPSLGKKCTVFCDDVAMPSKDTYGSQAP 2373

  Fly  2632 HTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFH 2696
            ..|:|.::|:.:|.|....|..::....::..|....||..|.|||.||....||:......:..
  Fly  2374 LELLRTWLDHGYWSDLVDTTKIELVDMTLMCAMGTLGGSNFIFPRLYRHMFVVAVDSFEDSTIVR 2438

  Fly  2697 ILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTG 2761
            |..:|...|..   :.:.:.|..|...:....::::...:.|||||..|.||:|:||||..:|.|
  Fly  2439 IFTTIGDWHFS---KGYPEKVALLSRGLSEAMVSVYRDAIRSFLPTPAKSHYSFSLRDITRVFQG 2500

  Fly  2762 VLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGI------------- 2813
            ::....:..|:..::.|||.||.|||:.|:|||..|.:....:..|..:..:             
  Fly  2501 IVMVPPKRMPDPEKLGRLWAHETYRVFYDRLVDQQDRDRLLVMAVDACKSNLRFPLEQAFGERIE 2565

  Fly  2814 --EGVNDDVVYAQPLIYCHFAKGLTDIK-YMPISGWDRLKSLLDEAQDRYNDYIGA-MNLVLFDD 2874
              |.:.|:.:  :.|.|.::.:...:.| |.....:::|:.|:......||.:... |:||:|..
  Fly  2566 PGEKLTDNDL--RNLFYGNYMEPDAEPKFYDEGDTYEKLEKLMKYYLREYNSFSSTPMDLVMFRF 2628

  Fly  2875 AMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATL 2939
            |:.||.|:||:|:..||..|::|:||||::|..|||::|:...:..:|::|.|:::|.:.::..:
  Fly  2629 AIEHVSRVSRVLQMPRGNILMVGMGGSGRRSSARLAAYIADCRLMTVQVSKSYTITDWRDDLKKI 2693

  Fly  2940 YMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLG-IV 3003
            .|.|....:...||.:|::...|.::..:|.:|.:||:..|:..::...|:..:.|..|||| |:
  Fly  2694 LMSASFNLNHTVFLFSDAQATDEGYVEDINGILNTGDLPNLYQLEDKATIMENMANVAKQLGKIL 2758

  Fly  3004 DN-RENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLR 3067
            |. ....:.|:|:::|..|.:.|.|||:|.:.:.|.|.:|:|:||.||||:..||::||..|.:.
  Fly  2759 DTLPSEVYAYYIDRIREQLHIALAFSPIGDSFKERIRVYPSLINCCTIDWYMPWPEEALSRVGVY 2823

  Fly  3068 FLSEIT------------VLPKELALP----------------------VSNFMAFVHKTVNDIS 3098
            |:|.:.            |..|:.|.|                      :.:.:.:.|::|.|.|
  Fly  2824 FVSSMNLNRPHGEETQEPVQSKDAADPDEEEVRRETVGVEREQTQLEADLVDCVMYFHQSVVDAS 2888

  Fly  3099 KLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLK 3163
            :.......|.||.||.::|||:..:......|:......|.|...||.||.....:|..:|..|.
  Fly  2889 EKCYLELNRRNYVTPSAYLELLKAFRTFYTRKLDEITRLRDRYTTGLEKLDFAAGQVGEMQTNLY 2953

  Fly  3164 VQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPA 3228
            ..:.:||:.::|.|.:::.:..|..:..|::.....:|....:......|....||.|..:|.||
  Fly  2954 DLQPKLKVLSEETDRIMVNIERETAEAEKKKEVVGADEAAANEAAAAAQAIKDDCETDLAEAIPA 3018

  Fly  3229 LIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRS-------WKACRAF 3286
            :.||.||||||...::..:||..:||..|.....||.|:...|.....|.|       |......
  Fly  3019 MEAALEALNTLKPADIFIVKSMKNPPYGVKLTMEAVCVIRGIKPDRKPDPSGHMVEDYWGPSMRM 3083

  Fly  3287 MGNVDKFLDNLINYDKKHIHPDVIKAL-QPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDV 3350
            :.:: ||||:|..:||.:|.|.:||.: :.||.|.:|.||||.|.|.|..|:|.||    |..||
  Fly  3084 LSDM-KFLDSLKTFDKDNIPPPIIKRIREKYIADRDFVPEKIKAASMACEGICRWV----RAMDV 3143

  Fly  3351 Y----LVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEAS 3411
            |    .:|.||:.||.|:|.|:....:||.|....|..:.::|..|...:.|...:|::.:||..
  Fly  3144 YDKVARIVMPKKAALAEAEGELSQQMEKLNAKRAELQVILDKLQKLNDFFAEKSREKKRLEDEID 3208

  Fly  3412 KTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEK 3476
            .....::.|.:|:|||..||.||.|:.|.|...|..:.||:|:.....:|:|.||..||..:.:.
  Fly  3209 NCEKKLNRAEKLLGGLGGEKTRWSEAAKNLHESISNIVGDVLLAGGCTAYLGYFTTEYRVNILDD 3273

  Fly  3477 LWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQ 3541
             |....|...  |||::.......:.....|..|:..|||:|..|.||..|:..|.||.|:||||
  Fly  3274 -WNALCKRKH--IPSSETFSLATTLGHPMTIRAWSLAGLPADNFSVENGIIVTNSSRYSLLIDPQ 3335

  Fly  3542 LQGIKWVKT-KYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKK- 3604
            :|..||:|. :....|.|::.|..||:..:|.|::.|..:||||:||.:|..|.|:|.:.:||. 
  Fly  3336 VQANKWIKNMEKNNNLKVIKQSDANYMQVLELAITFGQPVLIENVGEKLDSNLTPILEKNVIKHK 3400

  Fly  3605 -GTVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERP 3668
             |..:|.||:.|::|..|||.:.|.|.||.|.||:....|::||.:|..||.:||||.||..|||
  Fly  3401 GGLFIKSGDQMIEYNPNFRLYITTCLRNPRYPPEVMVMVTVLNFMITEQGLREQLLAIVVAHERP 3465

  Fly  3669 DLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEA 3733
            ||:..:.:|..:....:..|..:|..:|..||::..|||||...:..|..:|..:::|:.|...|
  Fly  3466 DLQEKKEQLIIESARNRDALYTIESKILEVLSTSEGNVLEDENAINILSSSKILSEDIQEKQVIA 3530

  Fly  3734 KITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDR 3798
            ..|.::||:||:.|.|.::.::|::|.:::|..::|:||:||..|..:|.|.:|||..:::|.:|
  Fly  3531 VATEIEIDAARQQYIPVSKHSAILFFCISELANVDPMYQYSLSWFLNLFVNTILKAPKSDQLSER 3595

  Fly  3799 VENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLL-------RFPYMP 3856
            ::||.|..|...:....|.|||:|||:....:|:.|||:.|.||...|.|.|       ..|  |
  Fly  3596 LKNLNDYFTKSIYTNVCRSLFEKDKLVISLVMCLGILVSQGRVEKAALLFFLTGGIGYKTIP--P 3658

  Fly  3857 NQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGKSAIQ 3921
            |...  .||....|..:....:....|.|.:.:|.....|..|.|:.:|:..:.|......:.:.
  Fly  3659 NPLG--AWLPDKSWASVCKAADLEGLKNLPQMMETYSDEWHNFYDASNPDQLQLPAPHNTVNDMY 3721

  Fly  3922 RLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVE 3986
            .|.:::.:|||::..|:|:||...|...:::....:.:.:|.:|||:..:.|:||.|.||:..:.
  Fly  3722 FLIVIKSLRPDKLVPAVRAFITRNLDRSFVEPPPFDLAASFADSSPKIPLVFLLSAGSDPMASLF 3786

  Fly  3987 KLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKM-ESS 4050
            ...|....   ::...::||||||...||..|..|:::|.||:|||.|:...|:..||:.. :::
  Fly  3787 MFAKQRNM---YDKLKTISLGQGQGPRAEKMIMEAARHGQWVVLQNCHVAISWMGDLERICNDTT 3848

  Fly  4051 LSN-VHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDN--------FS 4106
            |:: .:..|||:.::.|:.     :.|..:|::::|:|||||.|:.||:|::..:        |:
  Fly  3849 LTDGANHDYRLWCTSYPSA-----VFPVSVLQNSVKMTNEPPKGLRANMHRSFTSDPLMRDKFFT 3908

  Fly  4107 DETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTR 4171
            :..|...|....:...:|:|.:|||||.|||:|||.|||..|.||..||.||:..|..::..:..
  Fly  3909 NAFLFSDSANKCWLRGVFALVFFHAVVQERREFGPLGWNIPYEFNESDLKISLLQLKMFINQSQS 3973

  Fly  4172 VPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELID---------------------GE 4215
            :|:....||.||..|||.:|||.||||..:.|.....|..|:                     ..
  Fly  3974 IPFRGHVYLTGECNYGGRVTDDKDRRLILSLLNMIYNPNTIEEDNYALSQSGTYRVPLSPTRLNS 4038

  Fly  4216 LEYCQGFPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAEI------------GFLTTVSERLF 4268
            :||...||.                  |..|.:||||.||:|            |.|.|.:    
  Fly  4039 IEYVSSFPL------------------SPHPEVYGLHENADINRNVKETNALISGVLLTQT---- 4081

  Fly  4269 RIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVEDRSPYI------IV 4327
                :|...:...||||   ::||....|.:.:|.:.|..|||.|    |....|.|      .|
  Fly  4082 ----DLMASVKASSSGG---AKEDPAIAICKQVLKQLPEEFNIDE----VSKTYPVIYTNSMNTV 4135

  Fly  4328 AFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQS 4392
            ..||..|.|.|::.:::||..:...:.|::.:...:|.....:.:.::|..|.|.:|||:..|.|
  Fly  4136 LRQELIRFNRLLSYIRKSLVNVGKAVVGQIAMIPELERTHASMVIGKLPADWLKKSYPSLKPLGS 4200

  Fly  4393 WFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKW 4457
            :.|||:.||...:.|: |...|...|::||:..||.:|.::|..:|||.:.:|.:.:...|| |:
  Fly  4201 YVSDLLARLAFFQEWI-DNGEPMVYWISGFYFTQSFITGVLQNYSRKNRFQIDMILIEFAVT-KF 4263

  Fly  4458 KEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDI------- 4515
            :.::...|..||||.|:|:|||||:.|...:.::|.|.||..:||:|::.|.:..:|:       
  Fly  4264 EVQVPGTPDIGAYIRGIFIEGARWNRKTKEVDESFSKVLFDTLPVIYLRPVLKALEDLPRSTAGG 4328

  Fly  4516 --KNVYECPVYKIRLR---------GPTFVWTFNLKSRERASKWTLAGVCLLLQ 4558
              :.:|:|||||...|         ...||....|:...:...|...|...|.|
  Fly  4329 EPETIYDCPVYKTSERRGVLSTTGHSTNFVMYLQLRCSRKPMHWINRGTACLCQ 4382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 103/615 (17%)
DHC_N2 1368..1770 CDD:285579 112/423 (26%)
P-loop_NTPase 1903..2132 CDD:304359 137/229 (60%)
P-loop_NTPase 2217..2352 CDD:304359 58/148 (39%)
P-loop_NTPase 2510..2783 CDD:304359 73/277 (26%)
P-loop_NTPase 2860..3127 CDD:304359 91/304 (30%)
MT 3140..3480 CDD:289543 113/352 (32%)
AAA_9 3509..3722 CDD:289547 87/216 (40%)
Dynein_heavy 3864..4549 CDD:281078 219/752 (29%)
Dnah3NP_647937.2 DHC_N2 1086..1489 CDD:285579 110/414 (27%)
P-loop_NTPase 1620..1847 CDD:304359 136/227 (60%)
P-loop_NTPase 1934..2079 CDD:304359 59/149 (40%)
P-loop_NTPase 2264..2522 CDD:304359 72/261 (28%)
P-loop_NTPase 2613..2916 CDD:304359 91/303 (30%)
MT 2929..3272 CDD:289543 112/348 (32%)
AAA_9 3304..3519 CDD:289547 87/215 (40%)
Dynein_heavy 3659..4373 CDD:281078 220/759 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93365631
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.