DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dhc64C

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001261432.1 Gene:Dhc64C FlyBaseID:FBgn0261797 Length:4661 Species:Drosophila melanogaster

Alignment Length:4892 Identity:1213/4893 (25%)
Similarity:2150/4893 (44%) Gaps:866/4893 (18%)


  Fly    94 LTDENMLNSLLIGDLLPNPLANLSILCDEV----FFPLLNNTVNQVGWTNVIANDMKTESQEMRN 154
            ||....:|:::......|..|.::...|:|    |..||.|.||:  |...|....|. :::..:
  Fly   207 LTAHQTVNNVIRKCAEENRKAKVADFGDKVEDSSFLNLLQNGVNR--WIAEIKKVTKL-NRDPGS 268

  Fly   155 GIAQMK---GLVINRTIFPLPICMDEVMQAAPAIAMGDISVVNPLMKHSLEFMVVKWLDSVEDLV 216
            |.|..:   .|.:.|.::.:     :..:.:|.:|:     ...::||...|......|:...|.
  Fly   269 GTALQEISFWLNLERALYRI-----QEKRESPEVAL-----TLDILKHGKRFHATVSFDTDTGLK 323

  Fly   217 NIKAGEKIYS--KENFPLPEAIFSFWESRLENLENLAEQLGD--RRIKTIGFVLEKIQSIFEHSY 277
            ...|....|:  .::||:.:.:.:   :.||.:....:|:..  |:::...:.:::...:.|...
  Fly   324 QALATVADYNPLMKDFPINDLLSA---TELEKIRPAVQQIFAHLRKVRNTKYPIQRCLKLIEAIS 385

  Fly   278 RRIVELVLESLAEARDITKCLSPLKRKMDK-FE-----TNDMDENRSDIRPLMLT-----IGLVW 331
            |.:.:.:|:.|...|.:.......:|.|:: ||     .::.|:.:..:|.::..     :.:||
  Fly   386 RDLSQQLLKVLGTRRLMHIPFDEFERVMNQCFEIFSCWDDEYDKLQGLLRDIVKKKRDEHLKMVW 450

  Fly   332 ----GHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGD------VDEAYKKLDINMQHL 386
                .|.:....:.:|.. |...|..|...:.|.:.|.....||      ..:.|.....:...:
  Fly   451 RVSPAHKKLQTRMEHMRK-FRRQHEQLRTVILRVLRPTKPAVGDDGNVVETKQPYSLDAADANAI 514

  Fly   387 EYYKLIYN-----ECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRL-EELKDLFNTVRDF 445
            |...|.|.     :|.:..|:       .|:.|.........::|:...|: ..|:|...|.::.
  Fly   515 EEVNLAYENVKEVDCLDITKE-------GSEAWEAAVKRYEEKIDRVETRITAHLRDQLGTAKNA 572

  Fly   446 QKLEKI------------VMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQR 498
            .::.:|            :.|.::..| |..::::.::..:::.:: .:||    |.:::.....
  Fly   573 NEMFRIFSRFNALFVRPHIRGAIREYQ-TQLIQRVKDDIEALHEKF-KVQY----PQSKSCRLSS 631

  Fly   499 DR-LSFKAKTDVMERMVSFQFEKGLEDTHDLLLAGSLLLRPIIKKHVEPLMHVIVDDFEEEIMCV 562
            .| |...|.:.:..|.:..|....|:...|:|..|       .:.|:|.                
  Fly   632 VRDLPPVAGSIIWARQIDNQLTMYLKRVEDVLGKG-------WETHIEG---------------- 673

  Fly   563 KKEFINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEYPLFDNERGGYV 627
                            .:|..|        ..||..||.                         :
  Fly   674 ----------------QKLKAD--------GDSFRAKLS-------------------------I 689

  Fly   628 SDIFNIMVQEIDD----FTKMLLDKWTVECWQGIQQDITLTLIEKDEANELRVNFTERLIFALKD 688
            ||:|:...:::.:    .|..:   :|:|.        |.:.|.:.....|||||...:|...|:
  Fly   690 SDVFHEWARKVQERNFGSTGRI---FTIES--------TRSRIGRGNVLRLRVNFLPEIITLAKE 743

  Fly   689 IKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQ- 752
            ::.::.||..|.:.:.....:.::::...:.|:.....|..|.|:.:  .:.|....:..||:: 
  Fly   744 VRNIKNLGFRVPLTIVNKAHQANQIYPYAISLIESVRTYERTLEKLN--NRSLAQNSVFKIEDRA 806

  Fly   753 ---------MKPLLDFIK------WNAFS-QRFIVMIFKMVKYLH---DRLVAAQENLEAIKESI 798
                     .|.:|:.:.      |.::. ..:::.:.:.|....   |.|:..:|.|:.   .:
  Fly   807 SIVPLVAGLRKDVLNLVSEGIGLIWESYKLDPYVIRLSECVTQFQEKVDDLLVVEEQLDV---DV 868

  Fly   799 RSWGKVPLFQRKDLNPALLLHTDPRE-----PILSIRAANAADTQRLIDLLMYVNLKLFFDIPRR 858
            ||                 |.|.|..     .||| :..:|.|.   :.|..|.||.::  :.|.
  Fly   869 RS-----------------LETCPYSAATFVEILS-KIQHAVDD---LSLRQYSNLSVW--VTRL 910

  Fly   859 YSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIIT--- 920
                       |||.:                   |:..:..:..::.:.|..:.:::|:.|   
  Fly   911 -----------DEEVE-------------------KKLALRLQAGIQAWTEALTGNKKEVDTSMD 945

  Fly   921 ------PFHRYELLKGLSQEERAL----FREYEIYVDEIIAENLV---------DSVITSSTYLR 966
                  |.|:   |.|..|.:.|:    ....::|:...|.|...         .:::||...|:
  Fly   946 TDAPAQPTHK---LGGDPQIQNAVHEIRITNQQMYLYPSIEEARFQIMQQFFAWQAIVTSQVRLQ 1007

  Fly   967 MEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPT 1031
               ..||:         :.|::.....:|||.|....|      .||::...      .:.|..:
  Fly  1008 ---STRYQ---------VGLEKHVSQTYRNLLTKLPEG------KILENAYG------AIEQKVS 1048

  Fly  1032 EVTN-MNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVK 1095
            ||.| ::.:..|..|.|                  |||..::|: ..|..:|||    ..|:::|
  Fly  1049 EVRNYVDEWLRYQSLWD------------------LQADMLYGR-LGEDVNLWI----KCLNDIK 1090

  Fly  1096 KFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTW--ETYEDFFVFL 1158
            :  ...|.|..|...             .|.|:.:...::...:.|  :..:|  |....|...|
  Fly  1091 Q--SRTTFDTSDTRR-------------AYGPIIIDYAKVQAKVTL--KYDSWHKEALGKFGTLL 1138

  Fly  1159 RLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILS 1223
            ...||.|...|        |..:.||         |:|            .::.......|..::
  Fly  1139 GTEMTSFHSKV--------SKSRTDL---------EMQ------------SIEAASTSDAVSFIT 1174

  Fly  1224 VLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPI 1288
            .:..:.:....:|...:..:|...:|.:..::|.:|.| .::.:...|.....:   .|:....|
  Fly  1175 YVQSLKKDMIAWDKQVEVFREAQRILERQRFQFPNTWL-HVDNIEGEWSAFNEI---IKRKDTAI 1235

  Fly  1289 QSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPC------------LSCYE-----LIDESDL 1336
            |: ||..::.:|:..|....|....||:......|.            |..:|     |.:|.|.
  Fly  1236 QT-QVASLQAKIVAEDKAVETRTVDFLNDWEKTKPTGGKIRPDDALQQLQIFESKYSRLKEERDN 1299

  Fly  1337 ELVALEERQRSLAESAV-----------LFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTIN 1390
            .:.|.|..:  |.||||           |.|||            ||:.|   |.....:.:.|:
  Fly  1300 VVKAKEALE--LQESAVPNNSAERMNVALEELQ------------DLRGV---WSELSKVWTQID 1347

  Fly  1391 DWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIR 1455
            :.::.||..:....:.|:.:....:|:.|...:|.:|.:.:::..:::.:.....:.||::.|::
  Fly  1348 ETREKPWLSVQPRKLRQQLEAMMAQLKELPARLRMYESYEYVKKLIQSYIKVNMLIVELKSDALK 1412

  Fly  1456 DRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTM 1520
            :|||.:|.:..:|.:.:.| .:|..:.|:||.:.|..||:|:..:..|||:|:.|:.:..:|...
  Fly  1413 ERHWKQLTKQLRVNWVLSD-LSLGQVWDVNLQKNEGIVKDIILVAQGEMALEEFLKQVRESWQNY 1476

  Fly  1521 EFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSW 1585
            |... |:.:...::::..::|...:::|...:..|..|.|...||.|...|:.:|:..:.:...|
  Fly  1477 ELDL-INYQNKCRIIRGWDDLFNKVKEHINSVAAMKLSPYYKVFEEEALTWEEKLNRINALFDVW 1540

  Fly  1586 FEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEH 1650
            .:|||:|.|||.||.||.||::.||.::.||..|..||..|:.::.....|:...|...  :...
  Fly  1541 IDVQRRWVYLEGIFSGSADIKTLLPVETSRFQSISSEFLGLMKKVTKSPKVMDVLNIPA--VQRS 1603

  Fly  1651 LEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLN 1715
            ||.|..:|...:|||.:|||.:|.|:||||||...|||:|:.|..|.|.:.:|..|::..:..:.
  Fly  1604 LERLADLLGKIQKALGEYLERERTSFPRFYFVGDEDLLEIIGNSKNIARLQKHFKKMFAGVAAIL 1668

  Fly  1716 LISGSKNAAGMVAKELEEYVPFLENCDC--SGKVEVWLNRITDKMRDTLRDQLKRSL----TFYD 1774
            |...:....|:.::|.|| |.|:.....  ..|:..||:.:..:||.||...|.:::    .|.|
  Fly  1669 LNEENNVILGISSREGEE-VHFMNPVSTVEHPKINEWLSLVEKQMRFTLASLLAQAVQDIKQFRD 1732

  Fly  1775 HK--PRHV--WIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQ-------- 1827
            .|  |:..  |..::.||..::..||:|:.:...|   :||..||     |:.:..|        
  Fly  1733 GKIDPQAYMEWCDKYQAQIVVLAAQILWSEDVESA---LQQASEN-----NQSKPMQRVLGNVES 1789

  Fly  1828 -LNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPK--- 1888
             ||.|...:|.:.....|:|:..:....||.|.|...::...|....:|||..::|..:||:   
  Fly  1790 TLNVLADSVLQEQPPLRRRKLEHLINEFVHKRTVTRRLLNNGVTSPKSFQWLCEMRFYFDPRQTE 1854

  Fly  1889 -IDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTK 1952
             :.....::.:|:|.|.:||||...|||.||||||||:|:||:|...:||:|.|||||||||:.|
  Fly  1855 VLQQLTIHMANARFFYGFEYLGVQDRLVQTPLTDRCYLTMTQALESRLGGSPFGPAGTGKTESVK 1919

  Fly  1953 DLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAI 2017
            .||..||..|.||||.|..|::::|.|..||.|.|||||||||||:...:||..:.|::.||:|:
  Fly  1920 ALGNQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSACSQQIQTIQEAL 1984

  Fly  2018 K----SKKQ--TFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISE 2076
            |    |.|:  |...:|:.:.:...:.:|||||||||||:.||:|||.|:|..||..||..||:|
  Fly  1985 KYEMDSNKESITVELVGKQVRVSPDMAIFITMNPGYAGRSNLPDNLKKLFRSLAMTTPDRQLIAE 2049

  Fly  2077 IMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDD--------R 2133
            :||.::||:.|..||.|.:..:.||.|.||.|.|||:||||:||||:.||.::||.        :
  Fly  2050 VMLFSQGFRSAEKLACKIVPFFKLCDEQLSNQSHYDFGLRALKSVLISAGNVKRDRIMKIKEQMK 2114

  Fly  2134 QR--------------PEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKR----NP 2180
            ||              ||.::|::::.:..:||:|.:|:|:...|:.|:||.:...|..    ..
  Fly  2115 QRGDENIDEASVAENLPEQEILIQSVCETMVPKLVAEDIPLLFSLLSDVFPNVGYTRAEMKGLKE 2179

  Fly  2181 EFEAVIKRSALDLKLQPEDG-----------FILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKT 2234
            |...|.:...|......|.|           ::.|::||.::..:.|.:.::|.:|:|||..|||
  Fly  2180 EIRKVCQEDYLVCGEGDEQGAAWMEKGLGSTWVDKVLQLYQISNLNHGLMMVGPSGSGKSTAWKT 2244

  Fly  2235 LNKT---YQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFS-ILMRDQANLGGTGPK-- 2293
            |.|.   ::..:...|.  ::|||::.:.|:|:::|:||||.||||: ||.:...|:.|...|  
  Fly  2245 LLKALERFEGVEGVAHV--IDPKAISKEALYGVLDPNTREWTDGLFTHILRKIIDNVRGEINKRQ 2307

  Fly  2294 WIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYI 2358
            ||:.|||:||.|:|:||:|:||||:|||.:.||::|...:|::||:..|:.||.|||||.|:::.
  Fly  2308 WIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPNVRVMFEVQDLKFATLATVSRCGMVWF 2372

  Fly  2359 NPQDLGWTPFIQSWLGTRTNS--------SEVSMLNVLFDK--YVPPLLDIFRTRLRSITP---- 2409
            :...|......:::| :|..|        ..|.::....||  .|.|.|.:.|.....:.|    
  Fly  2373 SEDVLSTEMIFENYL-SRLRSIPLEDGDEDFVGVIKPAKDKEEEVSPSLQVQRDIALLLLPFFSA 2436

  Fly  2410 ----------------ISDIARLQMTCYLLDSML----------TPQNVPNDCPKDWYEIY---- 2444
                            |.|..||:....|. |||          ..|:....|..|..|.|    
  Fly  2437 DGIVVRTLEYAMDQEHIMDFTRLRALSSLF-SMLNQAARNVLTFNAQHPDFPCSADQLEHYIPKA 2500

  Fly  2445 FVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHETK---KFFPWTNL 2506
            .|:.::|.|.........||..:     |:.....|  ||.|...:..||:|..   .:.||:|.
  Fly  2501 LVYSVLWSFAGDAKLKVRIDLGD-----FVRSVTTV--PLPGAAGAPIIDYEVNMSGDWVPWSNK 2558

  Fly  2507 VPQFELDMDLPLQSNL-VNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDK 2570
            ||..|::.......:: |.|.:|.|....:.|.:....||:|.||.|||||:.:.:.|.|||.  
  Fly  2559 VPVIEVETHKVASPDIVVPTLDTVRHESLLYTWLAEHKPLVLCGPPGSGKTMTLFSALRALPD-- 2621

  Fly  2571 YSVTNVPFNFYTTSEMLQRILEKPLEKKAGRN---YGPIG-NKRMIYFVDDMNMPEVDKYFTVQP 2631
            ..|..:.|:..||.|:|.:..:...|.:...|   ..|:. .|.::.|.|::|:|::|.|.|.:.
  Fly  2622 MEVVGLNFSSATTPELLLKTFDHYCEYRKTPNGVVLSPVQIGKWLVLFCDEINLPDMDSYGTQRV 2686

  Fly  2632 HTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNP--SAGSFTIDPRLQRHFCSFAVNPPSQDAL 2694
            .:.:||.:::..:|.........:.:...|...||  ..|...:..|..||.....|:.|.:.:|
  Fly  2687 ISFLRQLVEHKGFYRASDQAWVSLERIQFVGACNPPTDPGRKPLSHRFLRHVPIIYVDYPGETSL 2751

  Fly  2695 FHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKF------HYNFNLR 2753
            ..|..:            |.:|:::|...:...|..|...:|..:|.:..:|      ||.::.|
  Fly  2752 KQIYGT------------FSRAMLRLMPALRGYAEPLTNAMVEFYLASQDRFTQDMQPHYVYSPR 2804

  Fly  2754 DIANIFTGVLYS--NSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGV 2816
            ::.....|:..:  ..::.|... ::|||.||..|::.|:|||.::.....:.:..:.:|...|:
  Fly  2805 EMTRWVRGICEAIRPLDSLPVEG-LVRLWAHEALRLFQDRLVDDSERRWTNENIDLVGQKHFPGI 2868

  Fly  2817 NDDVVYAQPLIYCHFAKGLTDIKYMPISGWD-------RLKSLLDEAQDRYNDYIGAMNLVLFDD 2874
            |.:....:|::|.::...    .|||::..:       |||...:|..|        :.|||||:
  Fly  2869 NQEEALQRPILYSNWLSK----DYMPVNREELREYVHARLKVFYEEELD--------VPLVLFDE 2921

  Fly  2875 AMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATL 2939
            .:.||.||.||....:|:.|||||.|:||.:|:|..::::.|.:|||::...|:..|...::..:
  Fly  2922 VLDHVLRIDRIFRQPQGHLLLIGVSGAGKTTLSRFVAWMNGLSIFQIKVHNKYTSEDFDEDLRCV 2986

  Fly  2940 YMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGI-V 3003
            ..::|.|.....|::.:|.|....||..:|.|||:|::..||..||...::...:...::.|: :
  Fly  2987 LRRSGCKDEKIAFILDESNVLDSGFLERMNTLLANGEVPGLFEGDEYTTLMTQCKEGAQREGLML 3051

  Fly  3004 DNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRF 3068
            |:.:..:|:|.::|...|.||...:|....|:.|:...|||.|...::||.:|...||..|...|
  Fly  3052 DSSDELYKWFTQQVMRNLHVVFTMNPSTDGLKDRAATSPALFNRCVLNWFGDWSDSALFQVGKEF 3116

  Fly  3069 LSEI--------------TVLPKELALP-----VSNFMAFVHKTVNDISKLYLANAK------RY 3108
            .:.:              :|.|...|.|     |.|...:||:|      |:.|||:      |.
  Fly  3117 TTRVDLEKPNWHAPDFFPSVCPLVPANPTHRDAVINSCVYVHQT------LHQANARLAKRGGRT 3175

  Fly  3109 NYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKN 3173
            ...||:.:|:.|..:.||.:||.....:::|.|..||.|:|...::|:.:|..|.|::.||:.||
  Fly  3176 MAVTPRHYLDFIHHFVKLYNEKRSDLEEQQLHLNVGLNKIAETVEQVEEMQKSLAVKKQELQAKN 3240

  Fly  3174 QEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDV--TAKAKLCEEDFLKAQPALIAAQEAL 3236
            :.|:..:..:..:.::..|::  ...:|..:|..::.|  ..|.|....|..:.:||:|.||.|:
  Fly  3241 EAANAKLKQMFQDQQEAEKKK--IQSQEIQIRLADQTVKIEEKRKYVMADLAQVEPAVIDAQAAV 3303

  Fly  3237 NTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLI-NY 3300
            .::.|..|.|:::..:||..|.....::.:|.....     ..||:.||.:.. :.|::::: |:
  Fly  3304 KSIRKQQLVEVRTMANPPSVVKLALESICLLLGENA-----TDWKSIRAVIMR-ENFINSIVSNF 3362

  Fly  3301 DKKHIHPDVIKALQ-PYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERAL--- 3361
            ..::|..||.:.:: .|:.:.:::.||:...|.|...:..|.|....:.|:...|||....|   
  Fly  3363 GTENITDDVREKMKSKYLSNPDYNFEKVNRASMACGPMVKWAIAQIEYADMLKRVEPLREELRSL 3427

  Fly  3362 -------LESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDI 3419
                   |.|.||.||.          :.:||..:.|.:.||.:.:::.|..:.:.......:|.
  Fly  3428 EEQADVNLASAKETKDL----------VEQLERSIAAYKEEYAQLISQAQAIKTDLENVQAKVDR 3482

  Fly  3420 ANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYR--------QELQEK 3476
            :..|:..|..|:.||..:.:.....:..:.||:|:.:.||:|.|.|.:.||        |.||  
  Fly  3483 SIALLKSLNIERERWESTSETFKSQMSTIIGDVLLSAAFIAYGGYFDQHYRLNLFTTWSQHLQ-- 3545

  Fly  3477 LWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQ 3541
               .|....:..|..|      |.:.:..:...|....||:|.:..|||.:|.:..||||:|||.
  Fly  3546 ---AASIQYRADIART------EYLSNPDERLRWQANALPTDDLCTENAIMLKRFNRYPLIIDPS 3601

  Fly  3542 LQGIKWVKTKYGTGLVVLRLSQRNYLD-----QVERAVSNGSVLLIENIGENIDPVLNPLLGRQL 3601
            .|...::..:|..    .::::.::||     .:|.|:..|:.||:::: ||.||:|||:|.|:|
  Fly  3602 GQATTFLLNEYAG----KKITKTSFLDDSFRKNLESALRFGNPLLVQDV-ENYDPILNPVLNREL 3661

  Fly  3602 IKKG--TVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVK 3664
            .:.|  .::.:||::||.:..|.:.|.|:.....:.|::.::.|.:||||||..|:.|.|.:|:|
  Fly  3662 RRTGGRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDICSRVTFVNFTVTRSSLQSQCLNQVLK 3726

  Fly  3665 VERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVK 3729
            .||||::..|:.|.:.|..|::.|:.||..||..|:.|...:|:|.:::..||..||.|.:|..|
  Fly  3727 AERPDIDEKRSDLLKLQGEFRLRLRQLEKSLLQALNDAKGKILDDDSVITTLETLKKEAYDINQK 3791

  Fly  3730 VAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAF-----TVVFNNAMLKA 3789
            |.|......:|::..:.|.|.:...|.|||.::.|.:::.:||:|||.|     ||::||..|  
  Fly  3792 VDETDKVIAEIETVSQQYLPLSVACSNIYFTMDSLNQVHFLYQYSLKMFLDIFSTVLYNNPKL-- 3854

  Fly  3790 MAAEKLKDRVENL----IDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVE-PTELDFL 3849
               |...|..|.|    .|....| :...:||:...|:|.|...:|...|....|.. ..|.:|.
  Fly  3855 ---EGRTDHSERLGIVTRDLFQVC-YERVARGMIHIDRLTFALLMCKIHLKGTSESNLDAEFNFF 3915

  Fly  3850 LRFPYMPNQTSNFTWLTHVGWGGIRALNNQA----VFKGLEKDIEGSHKRWKKFVDSESPENEKF 3910
            ||  ......:|.|.:..:....|.::|..|    :|:.|.:.:. |......::...||| :..
  Fly  3916 LR--SREGLLANPTPVEGLSAEQIESVNRLALRLPIFRKLLEKVR-SIPELGAWLQQSSPE-QVV 3976

  Fly  3911 PGEWKGK-------SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTF---EES 3965
            |..|...       |::.:|.:::..||||:..|..:.:...||..::.....|...|.   ::.
  Fly  3977 PQLWDESKALSPIASSVHQLLLIQAFRPDRVIAAAHNVVNTVLGEDFMPNAEQELDFTSVVDKQL 4041

  Fly  3966 SPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEI-VAENAIEIASQYGHWVI 4029
            :..|.......||.|....|:.|...     .::...|:::|..:.. .||.||.:|.:.|.||:
  Fly  4042 NCNTPALLCSVPGFDASGRVDDLAAE-----QNKQISSIAIGSAEGFNQAERAINMACKTGRWVL 4101

  Fly  4030 LQNIHLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGM 4094
            |:|:||..:||..|||||.|  ...|:.:||||:.|.  :|.   :|..:|.:......|||.|:
  Fly  4102 LKNVHLAPQWLVQLEKKMHS--LQPHSGFRLFLTMEI--NPK---VPVNLLRAGRIFVFEPPPGI 4159

  Fly  4095 MANIHKALDNFSD-ETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTIS 4158
            .||:   |..||. ....|....:|...:.|.|.:|||:|.||.::.|.||.:.|.||..||.::
  Fly  4160 RANL---LRTFSTVPAARMMKTPSERARLYFLLAWFHAIVQERLRYVPLGWAKKYEFNESDLRVA 4221

  Fly  4159 VYVLYNYLEANT---------RVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLE---------- 4204
            ...|..:::...         :|||:.|..|..:.:|||.|.:|:|:||..::|:          
  Fly  4222 CDTLDTWIDTTAMGRTNLPPEKVPWDALVTLLSQSIYGGKIDNDFDQRLLTSFLKKLFTARSFEA 4286

  Fly  4205 EFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVSERLFR 4269
            :|.....:||.....:....|...:...:..:|::....::||..||.:|||...|||....|..
  Fly  4287 DFALVANVDGASGGLRHITMPDGTRRDHFLKWIENLTDRQTPSWLGLPNNAEKVLLTTRGTDLVS 4351

  Fly  4270 IVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVEDRSPYIIVAFQE--- 4331
            .:.::|           .:..:|.:...:||..:::        .:||.||..|..:.....   
  Fly  4352 KLLKMQ-----------QLEDDDELAYSVEDQSEQS--------AVGRGEDGRPSWMKTLHNSAT 4397

  Fly  4332 --CERMNNLMTELKRSLNELDLGL---------KGELTISSVMEDL----MVC------------ 4369
              .|.:...:..|||::..:...|         .|...:.:|:.||    ::|            
  Fly  4398 AWLELLPKNLQVLKRTVENIKDPLYRYFEREVTSGSRLLQTVILDLQDVVLICQGEKKQTNHHRS 4462

  Fly  4370 ----LYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRL---------------RELEGWVADFRMPS 4415
                |....:|:.|.:...|:...:..|.:|...|:               :||:|:        
  Fly  4463 MLSELVRGIIPKGWKRYTVPAGCTVIQWITDFSNRVQQLQKVSQLVSQAGAKELQGF-------- 4519

  Fly  4416 SIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGAY-INGLFMEGA 4479
            .:||.|..||::.:||..|..|:.|.|.|:.:.|:..:|   ...|....::..: :.||.::||
  Fly  4520 PVWLGGLLNPEAYITATRQCVAQANSWSLEELALDVTIT---DAGLKNDQKDCCFGVTGLKLQGA 4581

  Fly  4480 RWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGPTFVWTFNL--KSR 4542
            :.......:|...:.:|    ||..:|.:....:...:....|||....| ...::|.:|  .:.
  Fly  4582 QCKNNELLLASTIMMDL----PVTILKWIKISSEPRISKLTLPVYLNSTR-TELLFTVDLAVAAG 4641

  Fly  4543 ERASKWTLAGVCLLLQT 4559
            :.:..:...||.:|..|
  Fly  4642 QESHSFYERGVAVLTST 4658

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 100/630 (16%)
DHC_N2 1368..1770 CDD:285579 113/404 (28%)
P-loop_NTPase 1903..2132 CDD:304359 125/235 (53%)
P-loop_NTPase 2217..2352 CDD:304359 62/141 (44%)
P-loop_NTPase 2510..2783 CDD:304359 68/288 (24%)
P-loop_NTPase 2860..3127 CDD:304359 86/293 (29%)
MT 3140..3480 CDD:289543 86/362 (24%)
AAA_9 3509..3722 CDD:289547 76/220 (35%)
Dynein_heavy 3864..4549 CDD:281078 176/772 (23%)
Dhc64CNP_001261432.1 DHC_N1 240..839 CDD:285571 115/714 (16%)
DYN1 1022..4338 CDD:227570 981/3535 (28%)
DHC_N2 1326..1724 CDD:285579 117/418 (28%)
P-loop_NTPase 1870..2103 CDD:304359 123/233 (53%)
P-loop_NTPase 2227..2367 CDD:304359 63/142 (44%)
P-loop_NTPase 2572..2835 CDD:304359 67/278 (24%)
Cas4_I-A_I-B_I-C_I-D_II-B 2834..>2943 CDD:294426 34/121 (28%)
P-loop_NTPase 2916..3194 CDD:304359 86/284 (30%)
MT 3208..3544 CDD:289543 84/354 (24%)
AAA_9 3569..3784 CDD:289547 76/220 (35%)
Dynein_heavy 3925..4636 CDD:281078 177/763 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93335720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.